DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D19B and Plzf

DIOPT Version :9

Sequence 1:NP_477297.1 Gene:D19B / 38717 FlyBaseID:FBgn0022699 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_001285862.1 Gene:Plzf / 34622 FlyBaseID:FBgn0032401 Length:469 Species:Drosophila melanogaster


Alignment Length:352 Identity:76/352 - (21%)
Similarity:113/352 - (32%) Gaps:139/352 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   349 CTECEKVFRCPTALKKHMYKHTGE-ELPFACEICGKRFPINSVLRDHLLRHAGIKNHVCPYCGVG 412
            |:.||..|........|:.:|:|: ..||.|..||.||...:.|..|..:|:....|:||:||.|
  Fly   214 CSLCEVGFLDWREYDTHLRRHSGDLRKPFFCLQCGIRFNTRAALLVHQPKHSTETPHICPHCGKG 278

  Fly   413 KTTRQEWNKHILTHTKEKKYECRQCDHASHNKQALANHVKVVHEKRKDFACQYCGKTFGKSHACK 477
                .:|                        ||.|:||: :||...|...|..||.:.....|.|
  Fly   279 ----FKW------------------------KQGLSNHI-LVHNPEKQMLCDVCGYSTTHMKALK 314

  Fly   478 IHERSHTGEKCCECKICGKVFLFEKGLTKHLKTHEKRDLPKTQGTNALMGDGASGSSTIAKPSPH 542
            .|:..|||| ...|.:.|                                               
  Fly   315 SHKLLHTGE-FFACTVSG----------------------------------------------- 331

  Fly   543 LRGRVERVDIAQLAGTVANPIPSVNLPSWSPQVNFTKKEGQHICPDCGKGFNHVSNMKLHYKVVH 607
                                                          |....|...|:|||.: .|
  Fly   332 ----------------------------------------------CKHRANRKENLKLHIE-TH 349

  Fly   608 QKVKDFCCRFCPKRFAKKQYLRHHEYIHT--GEKPYECKVCGKHFRQEQVLKTHM-KVHDKPPRP 669
            ::.:||.|..|..:|::.:.|:.|...||  |...|:|::||....:...:|.|: :||.:.|  
  Fly   350 KQGRDFICEVCGCKFSQSKNLKRHALKHTENGPNRYKCQLCGFSSHRSDKMKEHVQRVHTEKP-- 412

  Fly   670 PGKPKEPAGPKAESSTAVKRQQPKNFE 696
                     .:.|.|..|....|.:||
  Fly   413 ---------VQLELSETVDSSFPDDFE 430

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
D19BNP_477297.1 zf-AD 12..83 CDD:214871
C2H2 Zn finger 255..275 CDD:275368
C2H2 Zn finger 283..335 CDD:275368
C2H2 Zn finger 318..338 CDD:275368
COG5048 <347..512 CDD:227381 44/163 (27%)
C2H2 Zn finger 349..369 CDD:275368 5/19 (26%)
C2H2 Zn finger 378..398 CDD:275368 7/19 (37%)
C2H2 Zn finger 406..426 CDD:275368 6/19 (32%)
C2H2 Zn finger 434..455 CDD:275368 5/20 (25%)
C2H2 Zn finger 463..483 CDD:275368 6/19 (32%)
C2H2 Zn finger 491..511 CDD:275368 2/19 (11%)
C2H2 Zn finger 586..607 CDD:275368 6/20 (30%)
C2H2 Zn finger 615..635 CDD:275368 5/19 (26%)
zf-H2C2_2 627..652 CDD:290200 9/26 (35%)
C2H2 Zn finger 643..663 CDD:275368 5/20 (25%)
PlzfNP_001285862.1 COG5048 <193..403 CDD:227381 66/312 (21%)
C2H2 Zn finger 214..234 CDD:275368 5/19 (26%)
C2H2 Zn finger 244..264 CDD:275368 7/19 (37%)
C2H2 Zn finger 272..292 CDD:275368 11/48 (23%)
C2H2 Zn finger 300..320 CDD:275368 6/19 (32%)
C2H2 Zn finger 330..349 CDD:275368 7/112 (6%)
C2H2 Zn finger 357..377 CDD:275368 5/19 (26%)
C2H2 Zn finger 387..408 CDD:275368 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446636
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.