DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D19B and CG11695

DIOPT Version :9

Sequence 1:NP_477297.1 Gene:D19B / 38717 FlyBaseID:FBgn0022699 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_572732.1 Gene:CG11695 / 32106 FlyBaseID:FBgn0030316 Length:544 Species:Drosophila melanogaster


Alignment Length:563 Identity:130/563 - (23%)
Similarity:207/563 - (36%) Gaps:139/563 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VCRTCLSTV---------DDSAAYDLFRVP-GLAKKLCVCTSLSVEQADGFPKNLCNVCFSKLND 66
            :||.||...         |||....   || .||:.:.....|.:...||..|:||..|:.:|.|
  Fly     2 ICRLCLDDAEHSVPIFDQDDSGDQP---VPSNLAELIEKHLQLVLLPNDGVSKSLCTQCWQQLAD 63

  Fly    67 LHDF-----------QKQCVDSVQKFQDLVASNAFACQTNFDVLDTSAAVADLPGEEEDNVHFDP 120
            ...|           |:..::...:.:|........|:...||   |.|.||  .||.:.:..|.
  Fly    64 FEQFCAMVMKKQLGLQQLKMEPFSEDEDADTKAQILCEPEIDV---SPAAAD--NEECNEIDGDA 123

  Fly   121 LLNSKIEIIENEEDVFKMLESVEKEVEEVEMEMEQPFGRVSQDDSFESGNDNDLDADFQISSDDD 185
            ..||:...|              :.....||.:..|..|                          
  Fly   124 SSNSRSSSI--------------RTTSLREMRLPSPIRR-------------------------- 148

  Fly   186 IPLAQRSRRGATRGSKAKGKPKSAAKRQEEESEESEETSSSDDSDGNPKDKPKRKRIPATERDR- 249
               ..|..|..|.......|.|:..|..:.|::|.|:.    :.:|:|:.:....|    |.|. 
  Fly   149 ---RMRLPRAVTAPKTQAVKAKARTKTHKAEADEDEDA----EGEGDPESRSSNSR----EMDSY 202

  Fly   250 ---HRLIDCHIC-------------------HQ----------KFKKAIRYEEHMKHHNDLLPFQ 282
               |..::|.||                   ||          ::||...|.:|:..|||...|:
  Fly   203 IALHGRLECCICGGDEQFPNFAEMKRHFRNHHQSLGYVVCCQRRYKKRALYVDHLHMHNDPNYFR 267

  Fly   283 CTVESCRKGFTTANGLRVHVEHAH-TETSAMHPCTYEGCNKSFARPVLLSFHMKRVHKVDTPQRD 346
            |.:  |.|...:.....||:...| .:......|  :.|:|.|::..||:.| .|||:   .:|:
  Fly   268 CKI--CSKQLVSRISYDVHMLRFHPNKDDLSFAC--DQCSKRFSKQFLLTIH-SRVHQ---QERN 324

  Fly   347 FPCTECEKVFRCPTALKKHMYK-HTGEELPFACEICGKRFPINSVLRDHLLRH--------AGIK 402
            ..|..|::.||....|:.||.: |....:||.|:.||.:|.    .:.:||.|        :.:.
  Fly   325 EQCKHCDRSFRTAVDLRLHMRRTHDPAFVPFICDSCGAKFK----TKQNLLVHKRTVHREGSQLP 385

  Fly   403 NHVCPYCGVGKTTRQEWNKHILTH---TKEKKYECRQCDHASHNKQALANHVKVVHEKRKDFACQ 464
            ...|..|.|..:......||:..|   ...::::|.||.....::..||.|:: .|..::...|.
  Fly   386 EVQCQECQVWLSDENSLRKHMYMHLDAASLRQWKCEQCGLEKGSRAKLAAHIR-YHHPKEYHKCT 449

  Fly   465 YCGKTFGKSHACKIHERSHTGEKCCECKICGKVFLFEKGLTKH 507
            :|.|.|..|.:.:.|..:|||:...||..|.:.|.....:.||
  Fly   450 HCAKEFKSSRSLEEHTATHTGQDLYECAFCERTFKNSGNMHKH 492

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
D19BNP_477297.1 zf-AD 12..83 CDD:214871 22/91 (24%)
C2H2 Zn finger 255..275 CDD:275368 9/48 (19%)
C2H2 Zn finger 283..335 CDD:275368 13/52 (25%)
C2H2 Zn finger 318..338 CDD:275368 7/19 (37%)
COG5048 <347..512 CDD:227381 45/173 (26%)
C2H2 Zn finger 349..369 CDD:275368 7/20 (35%)
C2H2 Zn finger 378..398 CDD:275368 6/19 (32%)
C2H2 Zn finger 406..426 CDD:275368 5/19 (26%)
C2H2 Zn finger 434..455 CDD:275368 6/20 (30%)
C2H2 Zn finger 463..483 CDD:275368 6/19 (32%)
C2H2 Zn finger 491..511 CDD:275368 5/17 (29%)
C2H2 Zn finger 586..607 CDD:275368
C2H2 Zn finger 615..635 CDD:275368
zf-H2C2_2 627..652 CDD:290200
C2H2 Zn finger 643..663 CDD:275368
CG11695NP_572732.1 zf-AD 2..81 CDD:285071 22/81 (27%)
C2H2 Zn finger 268..289 CDD:275368 5/22 (23%)
C2H2 Zn finger 299..319 CDD:275368 8/22 (36%)
C2H2 Zn finger 327..348 CDD:275368 7/20 (35%)
C2H2 Zn finger 357..376 CDD:275368 7/22 (32%)
C2H2 Zn finger 389..409 CDD:275368 5/19 (26%)
C2H2 Zn finger 420..440 CDD:275368 6/20 (30%)
C2H2 Zn finger 448..468 CDD:275368 6/19 (32%)
C2H2 Zn finger 476..494 CDD:275368 5/17 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S7841
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.950

Return to query results.
Submit another query.