DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D19B and CG10959

DIOPT Version :9

Sequence 1:NP_477297.1 Gene:D19B / 38717 FlyBaseID:FBgn0022699 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_572451.1 Gene:CG10959 / 31743 FlyBaseID:FBgn0030010 Length:443 Species:Drosophila melanogaster


Alignment Length:506 Identity:122/506 - (24%)
Similarity:198/506 - (39%) Gaps:114/506 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 LCNVCFSKLNDLHDFQKQCVD-----SVQKFQDLVASNAFAC-QTNFDVLDTSAAVADLPGEEED 114
            |.||.:.:|:.....:.:|.:     ...:|| ||   ...| ..:|...|.:..:.        
  Fly     6 LANVDYVRLHAQQQLRPKCGEIFYEPEANRFQ-LV---CLLCDMKHFGFEDFARHIR-------- 58

  Fly   115 NVHFDPLLNSKIEIIENEEDVFKMLESVEKEVEEVEMEMEQPFGRVSQD----DSFES------- 168
            |||||          :....:.|.:..:.:...|     ||.|..||.:    |||:.       
  Fly    59 NVHFD----------KQGRPLTKTVTGLGRLARE-----EQEFQGVSAEPLAVDSFKKEYLPNED 108

  Fly   169 --GNDNDLDADFQISSDDDIPLAQRSRRGATRGSKAKGKPKSAAKRQEEES-----EESEETSSS 226
              ..:.|.:.:..:..|:..||     |....|.|         :..:||:     :...::||:
  Fly   109 VLSEEEDAEQELGLEQDEGNPL-----RIMVLGGK---------QSVDEETIDTMWQPDHDSSSA 159

  Fly   227 DDSDG----------NPKDKPKRKRIPATERDRHRLIDCHICHQKFKKAIRYEEHMKHHNDLLPF 281
            ..::|          ||:|..     |..:.:.|:.:        |||    :...|.:|     
  Fly   160 SVNEGCALEALLGVENPQDYQ-----PDEDGEEHQSV--------FKK----QRQPKDYN----- 202

  Fly   282 QCTVESCRKGFTTANGLRVHVEHAHTETSAMHPCTYEGCNKSFARPVLLSFHMKRVHKVDTPQRD 346
             |  ..|.:.:||...|..|::.:|....|. .|.  .|..:|.....|:.|.::.|      .:
  Fly   203 -C--PHCDRRYTTQKYLNTHLKMSHPFPQAF-KCV--DCKATFDVDRALAQHRRKEH------TE 255

  Fly   347 FPCTECEKVFRCPTALKKHMYKHTGEELPFAC--EICGKRFPINSVLRDHLLRHAGIKNHVCPYC 409
            |.|..|:|||:...:|.:|:..|:|.. .|.|  |.|||.|.....|..|...|:..:|:||..|
  Fly   256 FACQLCDKVFKSSRSLLRHVQGHSGAR-TFKCEHENCGKSFVNQHNLTSHRRVHSEERNYVCELC 319

  Fly   410 GVGKTTRQEWNKHILTHTKEKKYECRQCDHASHNKQALANHVKVVHEKRKDFACQYCGKTFGKSH 474
            |.....|:....|..|||.||.::|:.|.....:|..|..| :.:|...|.:.|..|...|.:..
  Fly   320 GYRSRYREALIVHRRTHTGEKPFQCQTCARRFASKSLLNEH-QAMHSTEKPYKCDKCDSAFSRPK 383

  Fly   475 ACKIHERSHTGEKCCECKICGKVFLFEKGLTKHLKTHE-KRDLPKTQGTNA 524
            |...|:..|.|.|..:|||||..:....||:.|::.|: :..:..|:|..|
  Fly   384 ALYHHKHLHLGIKKFKCKICGNAYAQAAGLSAHMRAHKLQASVNATEGAEA 434

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
D19BNP_477297.1 zf-AD 12..83 CDD:214871 6/31 (19%)
C2H2 Zn finger 255..275 CDD:275368 4/19 (21%)
C2H2 Zn finger 283..335 CDD:275368 13/51 (25%)
C2H2 Zn finger 318..338 CDD:275368 4/19 (21%)
COG5048 <347..512 CDD:227381 55/166 (33%)
C2H2 Zn finger 349..369 CDD:275368 7/19 (37%)
C2H2 Zn finger 378..398 CDD:275368 8/21 (38%)
C2H2 Zn finger 406..426 CDD:275368 5/19 (26%)
C2H2 Zn finger 434..455 CDD:275368 5/20 (25%)
C2H2 Zn finger 463..483 CDD:275368 5/19 (26%)
C2H2 Zn finger 491..511 CDD:275368 8/19 (42%)
C2H2 Zn finger 586..607 CDD:275368
C2H2 Zn finger 615..635 CDD:275368
zf-H2C2_2 627..652 CDD:290200
C2H2 Zn finger 643..663 CDD:275368
CG10959NP_572451.1 C2H2 Zn finger 232..253 CDD:275368 5/22 (23%)
COG5048 <258..416 CDD:227381 53/159 (33%)
C2H2 Zn finger 258..278 CDD:275368 7/19 (37%)
C2H2 Zn finger 289..308 CDD:275368 7/18 (39%)
C2H2 Zn finger 316..336 CDD:275368 5/19 (26%)
zf-H2C2_2 328..353 CDD:290200 8/24 (33%)
C2H2 Zn finger 344..364 CDD:275368 5/20 (25%)
zf-H2C2_2 357..381 CDD:290200 7/24 (29%)
C2H2 Zn finger 372..392 CDD:275368 5/19 (26%)
C2H2 Zn finger 400..420 CDD:275368 8/19 (42%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.