DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment D19B and hinf-1

DIOPT Version :9

Sequence 1:NP_477297.1 Gene:D19B / 38717 FlyBaseID:FBgn0022699 Length:774 Species:Drosophila melanogaster
Sequence 2:NP_493579.2 Gene:hinf-1 / 173348 WormBaseID:WBGene00009553 Length:541 Species:Caenorhabditis elegans


Alignment Length:453 Identity:102/453 - (22%)
Similarity:151/453 - (33%) Gaps:165/453 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 DADFQISSDD---DIPLAQRSRRGATRGSKAKGKPKSAAKRQEEESEESEET-----------SS 225
            |:|.|.|.|.   ..|::     .|||.|....:...|:....|..|.|||.           .|
 Worm    71 DSDSQDSVDSFRTPAPIS-----SATRFSTHTPRASRASSNDSESGELSEEVMNHWLPMTWCERS 130

  Fly   226 SDD--------------SDGNPKDKPKRKRIPATERDRHRLIDCHICHQKFKKAIRYEEHMKHHN 276
            |||              |..:.||:               .:| |:    |......||.:::.|
 Worm   131 SDDPQVFTFVCLWGQCVSSSSSKDE---------------FVD-HL----FGHVSVIEEGVQNGN 175

  Fly   277 DLLPFQCTVESCRKGFTTANGLRVHV---------------------EHAHTETSAMHPCT---Y 317
            .:...||.|..|.|...:...|..||                     ::...|:....|||   |
 Worm   176 HMNTVQCKVRGCNKHLDSIFQLHRHVSMHVFQADCQQKGSEALIEKEDYIGIESCGFEPCTNINY 240

  Fly   318 EG---------CNKSFARPVLL----SFHMKRVHKVDTPQRD---------FPC--TECEKVFRC 358
            ||         |...|.....|    ..|:..|..||..|::         |||  |.|.:|...
 Worm   241 EGMLLNCQWEDCGMPFNSLTELFDHVGHHIDGVGDVDRIQQNFSNGDKKVVFPCKWTACTQVADS 305

  Fly   359 PTALKKHMYKHTGEEL----------------------------------PFACEICGKRFPINS 389
            ...|::|...|:||::                                  |:.|::|.|||....
 Worm   306 KANLRRHARHHSGEKVLACPFCARFFSRRDKLYDHCLRRTILMKNPEMEDPYLCKLCQKRFGTEK 370

  Fly   390 VLRDHLLRHAGIKNHVCPYCGVGKTTRQEWNKHILTHTKEKKYECRQCDHASHNKQALANHVKVV 454
            .|..|:.||  :.:..||.|.:|...|.|.::|::|               .|::::        
 Worm   371 ALCMHVTRH--LVSLTCPLCSLGLGCRAELHRHLMT---------------KHSRRS-------- 410

  Fly   455 HEKRKDFACQYCGKTFGKSHACKIHERSHTGEKCCECKICGKVFLFEKGLTKHLKTHEKRDLP 517
                |||.|..|.|.|........|...|: :....||.|.:.|.::|.|.||:|.|::...|
 Worm   411 ----KDFKCDTCSKLFFTESELNRHAVYHS-DVMYSCKHCPEKFKWKKQLMKHMKEHDENFNP 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
D19BNP_477297.1 zf-AD 12..83 CDD:214871
C2H2 Zn finger 255..275 CDD:275368 4/19 (21%)
C2H2 Zn finger 283..335 CDD:275368 18/88 (20%)
C2H2 Zn finger 318..338 CDD:275368 6/32 (19%)
COG5048 <347..512 CDD:227381 48/200 (24%)
C2H2 Zn finger 349..369 CDD:275368 6/21 (29%)
C2H2 Zn finger 378..398 CDD:275368 7/19 (37%)
C2H2 Zn finger 406..426 CDD:275368 7/19 (37%)
C2H2 Zn finger 434..455 CDD:275368 1/20 (5%)
C2H2 Zn finger 463..483 CDD:275368 5/19 (26%)
C2H2 Zn finger 491..511 CDD:275368 9/19 (47%)
C2H2 Zn finger 586..607 CDD:275368
C2H2 Zn finger 615..635 CDD:275368
zf-H2C2_2 627..652 CDD:290200
C2H2 Zn finger 643..663 CDD:275368
hinf-1NP_493579.2 C2H2 Zn finger 299..316 CDD:275368 4/16 (25%)
C2H2 Zn finger 324..344 CDD:275368 0/19 (0%)
C2H2 Zn finger 359..379 CDD:275368 7/19 (37%)
C2H2 Zn finger 385..406 CDD:275368 8/35 (23%)
C2H2 Zn finger 415..435 CDD:275368 5/19 (26%)
C2H2 Zn finger 442..462 CDD:275368 9/19 (47%)
C2H2 Zn finger 473..494 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.