DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10274 and CG8159

DIOPT Version :9

Sequence 1:NP_001097525.1 Gene:CG10274 / 38716 FlyBaseID:FBgn0035690 Length:863 Species:Drosophila melanogaster
Sequence 2:NP_649823.2 Gene:CG8159 / 41040 FlyBaseID:FBgn0037619 Length:399 Species:Drosophila melanogaster


Alignment Length:596 Identity:108/596 - (18%)
Similarity:182/596 - (30%) Gaps:224/596 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VCRICLNRLPENGGGAGSFDLFLIPGLAK---KLCVCTSLAVEQSDGFPKCLCAQCFSRLDDMHE 76
            |||:|.:    :...:.|..|| ..|..|   ::.:.|.:.::...|.|..:|..|.:.|.....
  Fly     5 VCRVCAS----STDNSKSLKLF-NSGACKVLQQINLLTGVLLQCEPGLPDWMCETCQTDLKSAIS 64

  Fly    77 FQKLCVDSVQKFQDMVARNVFCPPASAQMKNFDLLNVAGNEPELVGQDEEDRINFDPLLDHKMEM 141
            |:..|:.|.:.|::                                                 .:
  Fly    65 FRDRCLRSQKIFEE-------------------------------------------------SL 80

  Fly   142 IENEEDVFKMLEHVDKEAEQVEKEVKQDELDAADLMTIFAAESSEESEEDIDQDVDFEPNSSDGD 206
            :.||||.|:........:::...|....:..|:.|..:...||....:|: |..:|...:.::.|
  Fly    81 VRNEEDTFRSSVRRSARSQRQRHEDTAPKTPASPLEVMIKLESLSNGDEE-DDGIDHLDSCNEAD 144

  Fly   207 DDVPLAQRLRDNSRMIPKAKAAVIKEEDQEFPTGSEEEDEDGEKSKSRRKRIPPGERHLHRIIDC 271
            .::.:              ||.            |...::||..|..|.||              
  Fly   145 MELAI--------------KAM------------SSSTEDDGTTSPVRLKR-------------- 169

  Fly   272 HICHQKFKKAIRYEEHMKHHNDLLPFQCKVETCRKGFTTAGGLRLHIDHAHTELSEVHSCNVDGC 336
                                           |.|:|....|                        
  Fly   170 -------------------------------TRRRGLKKGG------------------------ 179

  Fly   337 GKTFPRIRLLTFHMKKMHGITKAAAPPRDYPCTECEKVFRCPMALKKHMYKHDGKELPFPCNICG 401
                           |....||...|.  :.|.:|........:..:|:.||.|.. ||.|.:|.
  Fly   180 ---------------KGENRTKVTLPV--FFCDQCGNNITGKSSFDRHLRKHSGIR-PFQCELCP 226

  Fly   402 KRFVINSALKDHLMRHAGIKNYVCPYCGVGKTTRQEWNTHILTHTQEKKFKCHICEHASHNKQSL 466
            .||:.:..||.|.:.|.|                            ::||:|..|:....|....
  Fly   227 ARFLSSGELKGHQVMHTG----------------------------DRKFQCRYCDRTYVNYSGR 263

  Fly   467 ANHIKIVHEKIKNYACQYCGKTFGKSHACKIHEMTHTGEKRCECKVCGKKFLYPKSLTKHLKTHE 531
            ..|.: .|...:.:.|..|||:|..|:..|.|.:.||||:...|::|.:.|..|    .|||||.
  Fly   264 LRHER-THTNDRPFICAQCGKSFTNSYILKNHMLIHTGERLFRCELCHRSFARP----THLKTHF 323

  Fly   532 KRVLRAIETYRQR-QVEMGETPGEQF-------------DNPPAPPVEGISIE-PIMSRNAADEL 581
            :.     .|::.. :..|.:..|.|.             :..|....:..:|| |:.:....||.
  Fly   324 RS-----NTHKHNLEKSMADAGGVQLSPSQSADQVKFVTEKEPEAEADAFTIEVPLPAEQEQDES 383

  Fly   582 LKVCAESVATI 592
            |.:.|...:|:
  Fly   384 LGLAALETSTL 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10274NP_001097525.1 zf-AD 15..90 CDD:214871 19/77 (25%)
C2H2 Zn finger 334..353 CDD:275368 0/18 (0%)
C2H2 Zn finger 368..388 CDD:275368 3/19 (16%)
COG5048 394..729 CDD:227381 52/214 (24%)
C2H2 Zn finger 397..417 CDD:275368 7/19 (37%)
C2H2 Zn finger 425..445 CDD:275368 0/19 (0%)
C2H2 Zn finger 453..474 CDD:275368 4/20 (20%)
C2H2 Zn finger 482..502 CDD:275368 8/19 (42%)
C2H2 Zn finger 510..530 CDD:275368 7/19 (37%)
C2H2 Zn finger 638..659 CDD:275368
C2H2 Zn finger 667..687 CDD:275368
zf-H2C2_2 680..704 CDD:290200
C2H2 Zn finger 695..715 CDD:275368
CG8159NP_649823.2 zf-AD 5..78 CDD:214871 19/77 (25%)
C2H2 Zn finger 194..214 CDD:275368 3/19 (16%)
COG5048 <197..322 CDD:227381 42/158 (27%)
zf-H2C2_2 206..231 CDD:290200 10/25 (40%)
C2H2 Zn finger 222..242 CDD:275368 7/19 (37%)
C2H2 Zn finger 250..270 CDD:275368 4/20 (20%)
zf-H2C2_2 265..287 CDD:290200 7/22 (32%)
C2H2 Zn finger 278..298 CDD:275368 8/19 (42%)
zf-H2C2_2 291..315 CDD:290200 9/23 (39%)
C2H2 Zn finger 306..328 CDD:275368 9/30 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.