DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10274 and ouib

DIOPT Version :9

Sequence 1:NP_001097525.1 Gene:CG10274 / 38716 FlyBaseID:FBgn0035690 Length:863 Species:Drosophila melanogaster
Sequence 2:NP_649822.2 Gene:ouib / 41039 FlyBaseID:FBgn0037618 Length:312 Species:Drosophila melanogaster


Alignment Length:463 Identity:97/463 - (20%)
Similarity:145/463 - (31%) Gaps:168/463 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 VHAVCRIC-LNRLPENGGGAGSFDLFLIPG--LAKKLCVCTSLAVEQSDGFPKCLCAQCFSRLDD 73
            ::.|||:| ..::.|.     |.:||.:..  ..|.|.:.:.|.:...|..|..:|..|.:.|..
  Fly     2 LNIVCRVCGRQKICEK-----SLNLFDLVNRKYLKHLHMISGLRLVDLDDVPGFMCLCCQAELRS 61

  Fly    74 MHEFQKLCVDSVQKFQDMVARNVFCPPASAQMKNFDLLNVAGNEPELVGQDEEDRINFDPLLDHK 138
            ...|:|||:.:..|:..:                         |.:....||:...|.:      
  Fly    62 ALAFRKLCIKTQTKWLTI-------------------------EDDSSSGDEDTNDNSE------ 95

  Fly   139 MEMIENEEDVFKMLEHVDKEAEQVEKEVKQDELDAADLMTIFAAESSEESEEDIDQDVDFEPNSS 203
               :|:|:..|..... .||.|.|| |..|..::                ||.:|:.::      
  Fly    96 ---LESEKCAFSDFGK-KKEGELVE-ETFQVLIE----------------EEPMDKTLN------ 133

  Fly   204 DGDDDVPLAQRLRDNSRMIPKAKAAVIKEEDQEFPTGSEEEDEDGEKSKSRRKRIPPGERHLHRI 268
                        ||       |||.:             .||...||....:|.|....:...:|
  Fly   134 ------------RD-------AKAQL-------------REDGIDEKCVPSQKIIKVSTKLDDQI 166

  Fly   269 IDCHICHQKFKKAIRYEEHMKHHNDLLPFQCKVETCRKGFTTAGGLRLHIDHAHTELSEVHSCNV 333
            ..|.:|.........::.||:.|....||.||  .|...|.:||.||.|                
  Fly   167 YICELCGTHATSKPTFQRHMRKHRGERPFGCK--DCDARFLSAGELRAH---------------- 213

  Fly   334 DGCGKTFPRIRLLTFHMKKMHGITKAAAPPRDYPCTECEKVFRCPMALKKHMYKHDGKELPFPCN 398
                                |.:                               |.| |.||.|.
  Fly   214 --------------------HRV-------------------------------HTG-EQPFACR 226

  Fly   399 ICGKRFVINSALKDHLMRHAGIKNYVCPYCGVGKTTRQEWNTHILTHTQEKKFKCHICEHASHNK 463
            .|.||:|.......|...|...:.|||..||...||......|::.||.|:.|:|.||:.:...|
  Fly   227 FCEKRYVSYMGRLIHERTHTNDRPYVCEECGKKFTTAYVLKNHMVIHTGERNFRCDICDRSFQRK 291

  Fly   464 QSLANHIK 471
            ..|..|.:
  Fly   292 AHLVTHTR 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10274NP_001097525.1 zf-AD 15..90 CDD:214871 21/77 (27%)
C2H2 Zn finger 334..353 CDD:275368 0/18 (0%)
C2H2 Zn finger 368..388 CDD:275368 0/19 (0%)
COG5048 394..729 CDD:227381 27/78 (35%)
C2H2 Zn finger 397..417 CDD:275368 6/19 (32%)
C2H2 Zn finger 425..445 CDD:275368 6/19 (32%)
C2H2 Zn finger 453..474 CDD:275368 6/19 (32%)
C2H2 Zn finger 482..502 CDD:275368
C2H2 Zn finger 510..530 CDD:275368
C2H2 Zn finger 638..659 CDD:275368
C2H2 Zn finger 667..687 CDD:275368
zf-H2C2_2 680..704 CDD:290200
C2H2 Zn finger 695..715 CDD:275368
ouibNP_649822.2 zf-AD 5..78 CDD:214871 21/77 (27%)
COG5048 <158..300 CDD:227381 48/212 (23%)
C2H2 Zn finger 169..189 CDD:275368 4/19 (21%)
C2H2 Zn finger 197..217 CDD:275368 10/88 (11%)
zf-H2C2_2 209..234 CDD:290200 13/92 (14%)
C2H2 Zn finger 225..245 CDD:275368 6/19 (32%)
zf-H2C2_2 241..262 CDD:290200 7/20 (35%)
C2H2 Zn finger 253..273 CDD:275368 6/19 (32%)
zf-H2C2_2 266..288 CDD:290200 8/21 (38%)
C2H2 Zn finger 281..299 CDD:275368 6/17 (35%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.