DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10274 and nom

DIOPT Version :9

Sequence 1:NP_001097525.1 Gene:CG10274 / 38716 FlyBaseID:FBgn0035690 Length:863 Species:Drosophila melanogaster
Sequence 2:NP_001262384.1 Gene:nom / 41038 FlyBaseID:FBgn0037617 Length:370 Species:Drosophila melanogaster


Alignment Length:442 Identity:96/442 - (21%)
Similarity:160/442 - (36%) Gaps:132/442 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VCRIC-LNRL-PENGGGAGSFDLFLIPG---LAKKLCVCTSLAVEQSDGFPKCLCAQCFSRLDDM 74
            |||:| .:|| |:      :.:||. ||   :.:::.:.|.:.::|....|..:|..|.:.|...
  Fly     5 VCRVCGRSRLCPK------AVELFK-PGRQDILRRIQLITGILLQQIPNAPDMVCFCCQTDLQSA 62

  Fly    75 HEFQKLCVDSVQKFQDMVARNVFCPPASAQMKNFDLLNVAGNEPELVGQDEEDRIN-FDPLLDHK 138
            ..|::.|:...:|:..::                        :.:.||..||.::. .||  ..|
  Fly    63 MIFRRQCILQQKKWVPLL------------------------QSDKVGASEEKKVEPNDP--STK 101

  Fly   139 MEMIENEEDVFKM-LEHVDKEAEQVEKEVKQDELDAADLMTIFAAESSEESEEDIDQDVDFEPNS 202
            .:..:......:| ||.||        .|..:|..|:      |.||....|.|...::..||::
  Fly   102 KKTTKRRRGRPRMPLEIVD--------IVVTNESKAS------AGESVGGDEFDQPVEISNEPDA 152

  Fly   203 SDGDDDVPLAQRLRDNSRMIPKAKAAVIKEEDQEFPTGSEEEDEDGEKSKSRRKRIPPGERHLHR 267
            :|.|                       :..|:.:.|      ||||.:|......:     .:|:
  Fly   153 TDSD-----------------------VNLEEIDLP------DEDGLESDHDLPNV-----QIHK 183

  Fly   268 IIDCHICHQKFKKAIRYEEHMKHHNDLLPFQCKVETCRKGFTTAGGLRLHIDHAHTELSEVHSCN 332
            ...|.|........:|   |...||.:.|:.||  .|.|.|..|..|:.|               
  Fly   184 CDTCGIIKNNKSSLVR---HQFEHNGIRPYPCK--ECPKTFLVASELKAH--------------- 228

  Fly   333 VDGCGKTFPRIRLLTFHMKKMHGITKAAAPPRDYPCTECEKVFRCPMALKKHMYKHDGKELPFPC 397
                        .||.|         ...||  :.|..|::.:...:..|||...|. .|.||.|
  Fly   229 ------------NLTHH---------TLEPP--FACRYCDRRYFSVVGRKKHERVHT-NERPFVC 269

  Fly   398 NICGKRFVINSALKDHLMRHAGIKNYVCPYCGVGKTTRQEWNTHILTHTQEK 449
            :.|||.|.....||.|:..|..::.|.|..|....:.::...||.:::|.::
  Fly   270 DQCGKAFTRTCILKAHMAVHQVVRKYSCDVCDRSFSLKKHLATHFISNTHKR 321

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10274NP_001097525.1 zf-AD 15..90 CDD:214871 20/79 (25%)
C2H2 Zn finger 334..353 CDD:275368 3/18 (17%)
C2H2 Zn finger 368..388 CDD:275368 5/19 (26%)
COG5048 394..729 CDD:227381 17/56 (30%)
C2H2 Zn finger 397..417 CDD:275368 8/19 (42%)
C2H2 Zn finger 425..445 CDD:275368 4/19 (21%)
C2H2 Zn finger 453..474 CDD:275368
C2H2 Zn finger 482..502 CDD:275368
C2H2 Zn finger 510..530 CDD:275368
C2H2 Zn finger 638..659 CDD:275368
C2H2 Zn finger 667..687 CDD:275368
zf-H2C2_2 680..704 CDD:290200
C2H2 Zn finger 695..715 CDD:275368
nomNP_001262384.1 zf-AD 5..76 CDD:214871 19/77 (25%)
C2H2 Zn finger 184..204 CDD:275368 4/22 (18%)
C2H2 Zn finger 212..261 CDD:275368 18/88 (20%)
zf-H2C2_2 255..278 CDD:290200 12/23 (52%)
C2H2 Zn finger 269..289 CDD:275368 8/19 (42%)
zf-H2C2_2 282..305 CDD:290200 7/22 (32%)
C2H2 Zn finger 297..313 CDD:275368 2/15 (13%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24388
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.