DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10274 and CG17385

DIOPT Version :9

Sequence 1:NP_001097525.1 Gene:CG10274 / 38716 FlyBaseID:FBgn0035690 Length:863 Species:Drosophila melanogaster
Sequence 2:NP_001286418.1 Gene:CG17385 / 36603 FlyBaseID:FBgn0033934 Length:278 Species:Drosophila melanogaster


Alignment Length:272 Identity:72/272 - (26%)
Similarity:104/272 - (38%) Gaps:53/272 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 FQCKVETCRKGFTTAGGLRLHIDHAHTELSEVHSCNVDGCGKTFPRIRLLTFHMKKMHGITKAAA 361
            |.||  .|.:.|.:.....||....|......:.|.:  |.|:|.....|..|||..:.:     
  Fly    16 FSCK--RCDRTFRSKRDQTLHRQEVHNHNKTTYECKL--CAKSFCNSGNLDRHMKVHNDV----- 71

  Fly   362 PPRDYPCTECEKVFRCPMALKKHMYKHDGKELPFPCNICGKRFVINSALKDHLMRHAGIKNYVCP 426
              |.:.|..|.|.|...:.|::|...|.| |.||.||.|.|.|...|.:|.|.|.|.|.|.:.|.
  Fly    72 --RPFVCNICSKAFAQAVNLQRHYAVHSG-ERPFTCNFCNKSFTQQSNMKRHKMTHTGEKPFRCQ 133

  Fly   427 YCGVGKTTRQEWNTHILTHTQEKKFKCHICE----HASHNKQSLANHIK---------------- 471
            .||...:.......|.|.|...|.::|:.||    ..|:.|:.|.:|||                
  Fly   134 RCGRYFSQLVNLKKHKLGHLNAKPYQCNYCEKGFTQLSNFKRHLQSHIKEGVDVDVPASIQAAAA 198

  Fly   472 IVHEKIKN------YACQYCGKTFG-----KSHACKIHEMTHTGEKRCECKVCGKKFLYP----- 520
            :..|::::      :.|..|...|.     :.|..|.||    ..:|.:.:|.....::|     
  Fly   199 LARERLESEQKPSFFECMVCRAIFDTFADYEKHEAKCHE----DHERAQLEVNQMSHMHPDDYLP 259

  Fly   521 -KSLTKHLKTHE 531
             |.....|.|||
  Fly   260 MKFAVPDLDTHE 271

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10274NP_001097525.1 zf-AD 15..90 CDD:214871
C2H2 Zn finger 334..353 CDD:275368 7/18 (39%)
C2H2 Zn finger 368..388 CDD:275368 6/19 (32%)
COG5048 394..729 CDD:227381 46/175 (26%)
C2H2 Zn finger 397..417 CDD:275368 9/19 (47%)
C2H2 Zn finger 425..445 CDD:275368 5/19 (26%)
C2H2 Zn finger 453..474 CDD:275368 9/40 (23%)
C2H2 Zn finger 482..502 CDD:275368 7/24 (29%)
C2H2 Zn finger 510..530 CDD:275368 4/25 (16%)
C2H2 Zn finger 638..659 CDD:275368
C2H2 Zn finger 667..687 CDD:275368
zf-H2C2_2 680..704 CDD:290200
C2H2 Zn finger 695..715 CDD:275368
CG17385NP_001286418.1 COG5048 <13..181 CDD:227381 53/176 (30%)
C2H2 Zn finger 18..39 CDD:275368 6/22 (27%)
C2H2 Zn finger 48..68 CDD:275368 8/21 (38%)
C2H2 Zn finger 76..96 CDD:275368 6/19 (32%)
C2H2 Zn finger 104..124 CDD:275368 9/19 (47%)
C2H2 Zn finger 132..148 CDD:275368 3/15 (20%)
C2H2 Zn finger 160..180 CDD:275368 6/19 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449753
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.