DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10274 and CG30431

DIOPT Version :9

Sequence 1:NP_001097525.1 Gene:CG10274 / 38716 FlyBaseID:FBgn0035690 Length:863 Species:Drosophila melanogaster
Sequence 2:NP_610211.1 Gene:CG30431 / 35549 FlyBaseID:FBgn0050431 Length:418 Species:Drosophila melanogaster


Alignment Length:495 Identity:130/495 - (26%)
Similarity:178/495 - (35%) Gaps:131/495 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    15 VCRICLNRLP---ENGGGAGSFDLFLIPGLAKKL-CVCTSLAVEQSDGFPKCLCAQCFSRLDDMH 75
            |||.||...|   .:...|.|       .||.:| .:..:|.:|..|.....:|..|..||.|..
  Fly    11 VCRCCLLEQPPLYHSLYDASS-------QLAVELKALAPALRLEHGDNLTDVICDLCLRRLHDAR 68

  Fly    76 EFQKLCVDSVQKFQDMVARNVFCPPASAQMKNFDLLNVAGNEPELVGQDEEDRINFDPL-LDHKM 139
            :||:.|..|.|..               :|::....:...     ||         |.| ||..:
  Fly    69 DFQRRCEHSEQVL---------------RMRHEHWKHTVA-----VG---------DALALDDVL 104

  Fly   140 EMIENEE-----------DVFKMLEHVDKEAEQVEKEVKQDELDAADLMTIFAAESSEESEEDID 193
            |.:|.|.           ...|.:.||....|.|:.|    .||..|         |..||.||.
  Fly   105 ECLEREVGSLEGPMSVPLQASKPVAHVAPLMETVDFE----SLDFQD---------SSHSEHDIP 156

  Fly   194 QDVDFEPNSSDGDDDVPLAQRLRDNSRMIPKAKAAVIKEEDQEFPTGSEEEDED-GEKSKSRRKR 257
            .  .:|.:...|..:.|..|         |:. |.:...|....|..|||...| .||.|.||.|
  Fly   157 S--YWESSVDSGSLNTPHHQ---------PET-AELFAVEPPTPPESSEEPAPDAAEKPKMRRAR 209

  Fly   258 -----IPPGER------HLHRIIDCHICHQKFKKAIRYEEHMK--HHNDLLPFQCKVETCRKGFT 309
                 :.|.||      |...:..|..|.:||.:..:.:.||.  |....:.:||  |.|||.|.
  Fly   210 PRQDNVKPKERKASGAVHPRSLHPCPECEKKFTRNFQLKLHMTAVHGMGEMRYQC--EECRKNFA 272

  Fly   310 TAGGLRLHIDHAHTELSEVHSCNVDGCGKTF-PRIRLLTFHMKKMHGITKAAAPPRDYPCTECEK 373
            :...||.|:...|   |.........|.:.| .|.:||: |::...|    .|.||.:.|..|.|
  Fly   273 SRHSLRYHVKSVH---STERPFGCQHCDRRFILRTQLLS-HLRTHTG----EAKPRIFECQRCSK 329

  Fly   374 VFRCPMALKKHMYKHD-GKELPFPCNICGKRFVINSALKDHLMRHAGIKNYVCPYCGVGKTTRQE 437
            .:.....|:.||..|: ..|.||.|:.|.|.|.                            ||..
  Fly   330 SWPTKSDLRTHMRSHNPNMERPFKCDRCSKAFF----------------------------TRGH 366

  Fly   438 WNTHILTHTQEKKFKCHICEHASHNKQSLANHIKIVHEKI 477
            .|:|:|.||.||.|.|..|:....:..:|.||:..:|..|
  Fly   367 LNSHLLVHTGEKPFACEYCDKCYQSVGNLNNHMVRLHADI 406

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10274NP_001097525.1 zf-AD 15..90 CDD:214871 24/78 (31%)
C2H2 Zn finger 334..353 CDD:275368 6/19 (32%)
C2H2 Zn finger 368..388 CDD:275368 6/19 (32%)
COG5048 394..729 CDD:227381 23/84 (27%)
C2H2 Zn finger 397..417 CDD:275368 4/19 (21%)
C2H2 Zn finger 425..445 CDD:275368 5/19 (26%)
C2H2 Zn finger 453..474 CDD:275368 5/20 (25%)
C2H2 Zn finger 482..502 CDD:275368
C2H2 Zn finger 510..530 CDD:275368
C2H2 Zn finger 638..659 CDD:275368
C2H2 Zn finger 667..687 CDD:275368
zf-H2C2_2 680..704 CDD:290200
C2H2 Zn finger 695..715 CDD:275368
CG30431NP_610211.1 zf-AD 11..82 CDD:285071 24/92 (26%)
C2H2 Zn finger 234..255 CDD:275368 6/20 (30%)
C2H2 Zn finger 264..285 CDD:275368 9/22 (41%)
C2H2 Zn finger 293..313 CDD:275368 6/20 (30%)
zf-C2H2_8 305..373 CDD:292531 25/100 (25%)
C2H2 Zn finger 324..344 CDD:275368 6/19 (32%)
C2H2 Zn finger 354..374 CDD:275368 9/47 (19%)
zf-H2C2_2 366..389 CDD:290200 10/22 (45%)
C2H2 Zn finger 382..403 CDD:275368 5/20 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446644
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.