DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10274 and Plzf

DIOPT Version :9

Sequence 1:NP_001097525.1 Gene:CG10274 / 38716 FlyBaseID:FBgn0035690 Length:863 Species:Drosophila melanogaster
Sequence 2:NP_001285862.1 Gene:Plzf / 34622 FlyBaseID:FBgn0032401 Length:469 Species:Drosophila melanogaster


Alignment Length:462 Identity:106/462 - (22%)
Similarity:177/462 - (38%) Gaps:109/462 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   149 FKMLEHVDKEAEQVEKEVKQDELDAADLMTIFAAESSEESEE--DIDQDVDFEPNSSDGDDDVPL 211
            ::.|..|.||.|...:|:.| .|...:|:.::..:...|::|  :|....:.:||..        
  Fly    99 YEDLVSVSKEHELHFRELAQ-ILAVTELLNLYQLQPLGEAKEATEIPAPGEAQPNPD-------- 154

  Fly   212 AQRLRDNSRMIPKAKAAVIKEEDQEFPTGSEEEDEDGEKSKSRRKRIPPGERHLHRIIDCHI-CH 275
                       |:.||..:.|..|.:             .|.:..|.......::..|.|.. |:
  Fly   155 -----------PEKKAEAVFENRQSY-------------FKLKNPRAVKSSSKVNYCIGCDFKCY 195

  Fly   276 QKFKKAIRYEEHMKHHNDLLPFQCKVETCRKGFTTAGGLRLHIDHAHTELSEVHSCNVDGCGKTF 340
            |       .::.::|.....|.......|..||         :|.                    
  Fly   196 Q-------VQKMIEHMGSCEPSHLICSLCEVGF---------LDW-------------------- 224

  Fly   341 PRIRLLTFHMKKMHGITKAAAPPRDYPCTECEKVFRCPMALKKHMYKHDGKELPFPCNICGKRFV 405
               |....|:::..|..:     :.:.|.:|...|....||..|..|| ..|.|..|..|||.|.
  Fly   225 ---REYDTHLRRHSGDLR-----KPFFCLQCGIRFNTRAALLVHQPKH-STETPHICPHCGKGFK 280

  Fly   406 INSALKDHLMRHAGIKNYVCPYCGVGKTTRQEWNTHILTHTQEKKFKCHI--CEHASHNKQSLAN 468
            ....|.:|::.|...|..:|..||...|..:...:|.|.||.| .|.|.:  |:|.::.|::|..
  Fly   281 WKQGLSNHILVHNPEKQMLCDVCGYSTTHMKALKSHKLLHTGE-FFACTVSGCKHRANRKENLKL 344

  Fly   469 HIKIVHEKIKNYACQYCGKTFGKSHACKIHEMTHT--GEKRCECKVCGKKFLYPKSLTKHLKTHE 531
            ||: .|::.:::.|:.||..|.:|...|.|.:.||  |..|.:|::||    :....:..:|.|.
  Fly   345 HIE-THKQGRDFICEVCGCKFSQSKNLKRHALKHTENGPNRYKCQLCG----FSSHRSDKMKEHV 404

  Fly   532 KRVLRAIETYRQRQVEMGETPGEQF-DNPPAPPVEGI------SIEPIMSRNA-ADELLKVCAES 588
            :||    .|.:..|:|:.||....| |:...|.:|..      |::....||. .|:.||     
  Fly   405 QRV----HTEKPVQLELSETVDSSFPDDFELPVIETSPKKKPKSVKSKTIRNVNPDKRLK----- 460

  Fly   589 VATIPKD 595
             ..:||:
  Fly   461 -TLLPKE 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10274NP_001097525.1 zf-AD 15..90 CDD:214871
C2H2 Zn finger 334..353 CDD:275368 2/18 (11%)
C2H2 Zn finger 368..388 CDD:275368 6/19 (32%)
COG5048 394..729 CDD:227381 63/214 (29%)
C2H2 Zn finger 397..417 CDD:275368 7/19 (37%)
C2H2 Zn finger 425..445 CDD:275368 6/19 (32%)
C2H2 Zn finger 453..474 CDD:275368 7/22 (32%)
C2H2 Zn finger 482..502 CDD:275368 7/19 (37%)
C2H2 Zn finger 510..530 CDD:275368 4/19 (21%)
C2H2 Zn finger 638..659 CDD:275368
C2H2 Zn finger 667..687 CDD:275368
zf-H2C2_2 680..704 CDD:290200
C2H2 Zn finger 695..715 CDD:275368
PlzfNP_001285862.1 COG5048 <193..403 CDD:227381 63/260 (24%)
C2H2 Zn finger 214..234 CDD:275368 6/51 (12%)
C2H2 Zn finger 244..264 CDD:275368 6/19 (32%)
C2H2 Zn finger 272..292 CDD:275368 7/19 (37%)
C2H2 Zn finger 300..320 CDD:275368 6/19 (32%)
C2H2 Zn finger 330..349 CDD:275368 6/19 (32%)
C2H2 Zn finger 357..377 CDD:275368 7/19 (37%)
C2H2 Zn finger 387..408 CDD:275368 7/28 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45446643
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.