DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10274 and ZNF280B

DIOPT Version :9

Sequence 1:NP_001097525.1 Gene:CG10274 / 38716 FlyBaseID:FBgn0035690 Length:863 Species:Drosophila melanogaster
Sequence 2:NP_542942.2 Gene:ZNF280B / 140883 HGNCID:23022 Length:543 Species:Homo sapiens


Alignment Length:536 Identity:109/536 - (20%)
Similarity:188/536 - (35%) Gaps:114/536 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   143 ENEEDVFKMLEHVDKEAEQV---------------------------------------EKEVKQ 168
            |:.|.:|..:|||:::||.:                                       :.:.|.
Human    26 EDAELIFVGVEHVNEDAELIFVGVTSNSKPVVSNILNRVTPGSWSRRKKYDHLRKDTARKLQPKS 90

  Fly   169 DELDAADLMTIFAAESSEESEEDIDQDVDFEPNSS-DGDDDVPLAQRLRDNSRMIPK-------- 224
            .|...::.:|:..|  |:......|..:..||.|. |..:..|  |.:.:||..:|.        
Human    91 HETVTSEAVTVLPA--SQLESRSTDSPIIIEPLSKPDYRNSSP--QVVPNNSSELPSPLITFTDS 151

  Fly   225 ----AKAAVIKEEDQEFPTGSE-----EEDEDGEKSKSRRKRIPPGERHLHRIIDC-HICH-QKF 278
                ...|:......|.|..|:     |.:....|....|..|..|........|. |..: |:.
Human   152 LHHPVSTALSVGGINESPRVSKQLSTFEVNSINPKRAKLRDGIIEGNSSASFPSDTFHTMNTQQS 216

  Fly   279 KKAIRYEEHMKHHNDLLPFQCKVETCRKGFTTAGGLRLHIDHAHTELSEVHSCNVDGCGKTF--- 340
            ..:......:.|..:..||..........|..   :..::|.|: ||::....::....|||   
Human   217 TPSNNVHTSLSHVQNGAPFPAAFPKDNIHFKP---INTNLDRAN-ELAKTDILSLTSQNKTFDPK 277

  Fly   341 ---PRIRLLTFHMKKMHGITKAAAPPRD-----YPCTECEKVFRCPMAL---KKHM----YKHDG 390
               |.:.|..|:    :|..|....|..     :.|..|.||.:....:   |.|:    .::|.
Human   278 KENPIVLLSDFY----YGQHKGEGQPEQKTHTTFKCLSCVKVLKNVKFMNHVKHHLEFEKQRNDS 338

  Fly   391 KELPFPCNICGKRFVINSALKDHL--MRHAGIKNYVCPYCGVGKTTRQEWNTHILTHTQ--EKKF 451
            .|....|..|.::|.....|:.|:  :..|...:.||..|.:...|.|....|:..|.:  |..:
Human   339 WENHTTCQHCHRQFPTPFQLQCHIENVHTAQEPSTVCKICELSFETDQVLLQHMKDHHKPGEMPY 403

  Fly   452 KCHICEHASHNKQSLANHIKIVHEKIKNYACQYCGKTFGKSHACKIHEMTHTGEKRCECKVCGKK 516
            .|.:|.:.|.....:..|.:..||..||..|.:|.|.|..:.....|...|.|:...:|..|..:
Human   404 VCQVCHYRSSVFADVETHFRTCHENTKNLLCPFCLKIFKTATPYMCHYRGHWGKSAHQCSKCRLQ 468

  Fly   517 FLYPKSLTKHLKTHEKRVLRAIETYRQRQVEMGETPGEQFDNPPAPPVE-GISIEPIMSRNAADE 580
            ||..|...:| ||...::.:     :.:|:|         ..||...|. .:|:||:...:    
Human   469 FLTFKEKMEH-KTQCHQMFK-----KPKQLE---------GLPPETKVTIQVSLEPLQPGS---- 514

  Fly   581 LLKVCAESVATIPKDP 596
             :.|.:.:|:|...:|
Human   515 -VDVASITVSTSDSEP 529

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10274NP_001097525.1 zf-AD 15..90 CDD:214871
C2H2 Zn finger 334..353 CDD:275368 6/24 (25%)
C2H2 Zn finger 368..388 CDD:275368 6/26 (23%)
COG5048 394..729 CDD:227381 49/208 (24%)
C2H2 Zn finger 397..417 CDD:275368 5/21 (24%)
C2H2 Zn finger 425..445 CDD:275368 5/19 (26%)
C2H2 Zn finger 453..474 CDD:275368 4/20 (20%)
C2H2 Zn finger 482..502 CDD:275368 5/19 (26%)
C2H2 Zn finger 510..530 CDD:275368 7/19 (37%)
C2H2 Zn finger 638..659 CDD:275368
C2H2 Zn finger 667..687 CDD:275368
zf-H2C2_2 680..704 CDD:290200
C2H2 Zn finger 695..715 CDD:275368
ZNF280BNP_542942.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
DUF4195 45..225 CDD:290548 27/183 (15%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 105..138 8/34 (24%)
C2H2 Zn finger 345..366 CDD:275368 5/20 (25%)
C2H2 Zn finger 375..395 CDD:275368 5/19 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 518..543 3/12 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 57 1.000 Domainoid score I10859
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.