DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment fmt and AT1G08005

DIOPT Version :10

Sequence 1:NP_001261470.1 Gene:fmt / 38714 FlyBaseID:FBgn0035688 Length:996 Species:Drosophila melanogaster
Sequence 2:NP_001318952.1 Gene:AT1G08005 / 28716759 AraportID:AT1G08005 Length:55 Species:Arabidopsis thaliana


Alignment Length:53 Identity:13/53 - (24%)
Similarity:22/53 - (41%) Gaps:9/53 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly   465 NDAKRAEGGKDEEGGDIEIEVAAAQEVAAQTPDERQTAAEENQEHEEHMSQVE 517
            |.::|:...||.|...:|.:|         |....:.|.:.|:|..|.:...|
plant    12 NGSERSFFDKDVEFVGVEAQV---------TEKGMEQAMKMNKEMAEDLKTEE 55

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
fmtNP_001261470.1 SAPS 129..459 CDD:398279
AT1G08005NP_001318952.1 None
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.