DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prdm13 and ZNF462

DIOPT Version :9

Sequence 1:NP_648032.1 Gene:Prdm13 / 38713 FlyBaseID:FBgn0035687 Length:465 Species:Drosophila melanogaster
Sequence 2:XP_006717272.1 Gene:ZNF462 / 58499 HGNCID:21684 Length:2567 Species:Homo sapiens


Alignment Length:428 Identity:99/428 - (23%)
Similarity:151/428 - (35%) Gaps:103/428 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 LDSLEQKRSASLIFRIEQLLPSTSITPTSMTTSSTETTLTATT----STASPAKRMRMSNP--RP 65
            |.||.|::..:.:..:    |:.|  ..|.|::||..|:.|.:    :|.....|..|.|.  ||
Human   273 LSSLRQQQEGTNLPDV----PNKS--APSPTSNSTYLTMNAASREIPNTTVSNFRGSMGNSIMRP 331

  Fly    66 GVYASQYTPKDTCSMAIPTSALLGSTVMPTDGSR-SHCQLSNGEL-IVSGSLLRQIKLSEDVYSF 128
            ...||:::|.....|. |.|......|..|:.|| ....::|... :.:.|:|......|::   
Human   332 NSSASKFSPMSYPQMK-PKSPHNSGLVNLTERSRYGMTDMTNSSADLETNSMLNDSSSDEEL--- 392

  Fly   129 NAIFELHGGQVRVRLVRDVAREDEIVAWFGEELVLLMGIPFLTPLNIQGNSRYMCHLC-----HL 188
            |.|...:|..........::.| :::...|.:|:...||||...:|     |:.|..|     |.
Human   393 NEIDSENGLSAMDHQTSGLSAE-QLMGSDGNKLLETKGIPFRRFMN-----RFQCPFCPFLTMHR 451

  Fly   189 TFETPHPLKIHLALGCGRSAM---DILWMRLHYALKAAA--RSHTETQHSPIPATSSTSSAS--- 245
            ...:.|...|||:   |::|:   |........:||..|  :.||.|........|.:.|.|   
Human   452 RSISRHIENIHLS---GKTAVYKCDECPFTCKSSLKLGAHKQCHTGTTSDWDAVNSQSESISSSL 513

  Fly   246 ----------------------------PTHSPPPQMPPRFSAFRPIAALTQSLP---MVPVTTA 279
                                        |...|||..||..|..:|   |.|..|   ..|....
Human   514 NEGVVSYESSSINGRKSGVMLDPLQQQQPPQPPPPPPPPPPSQPQP---LQQPQPPQLQPPHQVP 575

  Fly   280 ATPLSYLPSMSMATAPLSTNPMNAAAQIEAIVSNMGASKQGHLCIYCGKVYSRKYGLKIHIRTHT 344
            ..|.:..|.......|....|::.                 :.|..|....:...||::| :.| 
Human   576 PQPQTQPPPTQQPQPPTQAAPLHP-----------------YKCTMCNYSTTTLKGLRVH-QQH- 621

  Fly   345 GFKPLKCKFC--LRPF-GDPSNLNKHVRLHLQTHPSSS 379
                 |..||  |..| |.||:|  .:.....:|||||
Human   622 -----KHSFCDNLPKFEGQPSSL--PLENETDSHPSSS 652

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prdm13NP_648032.1 COG5048 280..>380 CDD:227381 24/103 (23%)
C2H2 Zn finger 323..343 CDD:275368 5/19 (26%)
zf-H2C2_2 336..358 CDD:290200 7/23 (30%)
C2H2 Zn finger 351..371 CDD:275368 8/22 (36%)
zf-C2H2 406..427 CDD:278523
C2H2 Zn finger 408..427 CDD:275368
ZNF462XP_006717272.1 C2H2 Zn finger 2054..2074 CDD:275368
C2H2 Zn finger 2088..2108 CDD:275368
C2H2 Zn finger 2117..2138 CDD:275368
zf-H2C2_5 2144..2169 CDD:316431
C2H2 Zn finger 2146..2167 CDD:275368
C2H2 Zn finger 2317..2337 CDD:275368
C2H2 Zn finger 2363..2383 CDD:275368
C2H2 Zn finger 2391..2412 CDD:275368
C2H2 Zn finger 2477..2497 CDD:275368
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.