DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Prdm13 and si:dkey-154p10.3

DIOPT Version :9

Sequence 1:	NP_648032.1	Gene:	Prdm13 / 38713	FlyBaseID:	FBgn0035687	Length:	465	Species:	Drosophila melanogaster
Sequence 2:	XP_692110.2	Gene:	si:dkey-154p10.3 / 563659	ZFINID:	ZDB-GENE-070912-380	Length:	646	Species:	Danio rerio

Alignment Length:	125	Identity:	40/125 - (32%)
Similarity:	51/125 - (40%)	Gaps:	26/125 - (20%)

- Green bases have known domain annotations that are detailed below.

  Fly   323 CIYCGKVYSRKYGLKIHIRTHTGFKPLKCKFCLRPFGDPSNLNKHVRLHLQTHP--------SSS 379
            |.||.::   |..|..|:|.|||.||.||..|.....|.|:|.:|.|.|.|..|        ||.
Zfish   535 CHYCTRL---KASLIQHLRIHTGEKPYKCLQCSYASIDRSSLRRHSRTHTQEKPYCCQYCPYSSI 596

  Fly   380 AGVADGGASGADMDGDVDIEG---ETDADYQCHVCHKSFPRRRDLQRHMETRHGGHHSHS 436
            ....            :|:..   .|...:.||:|..|.|.|:.|.|||...|.|..:.|
Zfish   597 QKKC------------LDLHSRRHHTGESFPCHLCQYSTPDRQLLVRHMRKHHTGEQNSS 644

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Prdm13	NP_648032.1	COG5048	280..>380	CDD:227381	25/64 (39%)
		C2H2 Zn finger	323..343	CDD:275368	7/19 (37%)
		zf-H2C2_2	336..358	CDD:290200	11/21 (52%)
		C2H2 Zn finger	351..371	CDD:275368	7/19 (37%)
		zf-C2H2	406..427	CDD:278523	10/20 (50%)
		C2H2 Zn finger	408..427	CDD:275368	10/18 (56%)
si:dkey-154p10.3	XP_692110.2	C2H2 Zn finger	275..295	CDD:275368
		C2H2 Zn finger	303..323	CDD:275368
		C2H2 Zn finger	334..350	CDD:275368
		COG5048	<500..632	CDD:227381	34/111 (31%)
		C2H2 Zn finger	504..524	CDD:275368
		zf-H2C2_2	517..539	CDD:290200	2/3 (67%)
		C2H2 Zn finger	532..552	CDD:275368	7/19 (37%)
		C2H2 Zn finger	560..580	CDD:275368	7/19 (37%)
		zf-H2C2_2	572..594	CDD:290200	6/21 (29%)
		C2H2 Zn finger	588..608	CDD:275368	3/31 (10%)
		C2H2 Zn finger	616..636	CDD:275368	10/19 (53%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR24403
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
ZFIN	0	0.000	Not matched by this tool.
	1	1.100