Sequence 1: | NP_648032.1 | Gene: | Prdm13 / 38713 | FlyBaseID: | FBgn0035687 | Length: | 465 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_060667.2 | Gene: | ZFP64 / 55734 | HGNCID: | 15940 | Length: | 681 | Species: | Homo sapiens |
Alignment Length: | 302 | Identity: | 75/302 - (24%) |
---|---|---|---|
Similarity: | 106/302 - (35%) | Gaps: | 85/302 - (28%) |
- Green bases have known domain annotations that are detailed below.
Fly 170 LTPLNIQGNSRYMCHLCHLTFETPHPLKIHLALGC---GRSAMDILWMRLHYALKAAARSHTETQ 231
Fly 232 HSPIPATSSTSSASPTHSPPPQMPPRFSAFRPIAALTQSLPMVPVTTAATP--------LSYLPS 288
Fly 289 MS------------------MATAPLSTNPMNA---AAQIEAIVS--------NMGASKQGHLCI 324
Fly 325 YCGKVYSRKYGLKIHIRTHTGFKPLKCKFCLRPFGDPSNLNKHVRLHLQTHPSSSAGVADGGASG 389
Fly 390 ADMDGDVDIEGET-DADYQCHVCHKSFPRRRDLQRHMETRHG 430 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Prdm13 | NP_648032.1 | COG5048 | 280..>380 | CDD:227381 | 39/136 (29%) |
C2H2 Zn finger | 323..343 | CDD:275368 | 11/19 (58%) | ||
zf-H2C2_2 | 336..358 | CDD:290200 | 13/21 (62%) | ||
C2H2 Zn finger | 351..371 | CDD:275368 | 10/19 (53%) | ||
zf-C2H2 | 406..427 | CDD:278523 | 9/20 (45%) | ||
C2H2 Zn finger | 408..427 | CDD:275368 | 8/18 (44%) | ||
ZFP64 | NP_060667.2 | COG5048 | <151..450 | CDD:227381 | 45/135 (33%) |
zf-H2C2_2 | 161..186 | CDD:290200 | 5/24 (21%) | ||
C2H2 Zn finger | 177..197 | CDD:275368 | 11/19 (58%) | ||
zf-H2C2_2 | 190..211 | CDD:290200 | 13/20 (65%) | ||
C2H2 Zn finger | 205..225 | CDD:275368 | 10/19 (53%) | ||
zf-H2C2_2 | 217..239 | CDD:290200 | 7/21 (33%) | ||
C2H2 Zn finger | 233..253 | CDD:275368 | 1/21 (5%) | ||
C2H2 Zn finger | 261..281 | CDD:275368 | 8/19 (42%) | ||
zf-H2C2_2 | 273..297 | CDD:290200 | 6/11 (55%) | ||
C2H2 Zn finger | 289..308 | CDD:275368 | |||
C2H2 Zn finger | 373..391 | CDD:275368 | |||
zf-C2H2_6 | 425..450 | CDD:290623 | |||
C2H2 Zn finger | 427..447 | CDD:275368 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR24403 |
Phylome | 0 | 0.000 | Not matched by this tool. | |||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 1.100 |