DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prdm13 and zfp91

DIOPT Version :9

Sequence 1:NP_648032.1 Gene:Prdm13 / 38713 FlyBaseID:FBgn0035687 Length:465 Species:Drosophila melanogaster
Sequence 2:XP_021326898.1 Gene:zfp91 / 555616 ZFINID:ZDB-GENE-090313-11 Length:792 Species:Danio rerio


Alignment Length:147 Identity:33/147 - (22%)
Similarity:59/147 - (40%) Gaps:42/147 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly   318 KQGHLCIYCGKVYSRKYGLKIHIRTHTGFKPLKCKFCLRPFGDPSNLNKHVRLHLQTHPSSSAGV 382
            ::.::|.:|.:.:...:.|.:|...|||.|||:|:.|.......::||.|::.|           
Zfish   424 QRDYICEFCARAFKSSHNLAVHRMIHTGEKPLQCEICGFTCRQKASLNWHMKKH----------- 477

  Fly   383 ADGGASGADMDGDVDIEGETDADYQ--CHVCHKSFPRRRDLQRHMETRHGGHHSHSHSE---SRS 442
                              :.||.||  |.:|.|.|.::..:.        .|.:.||.|   :.:
Zfish   478 ------------------DADATYQFSCSICGKKFEKKDSVV--------AHKAKSHPEVLIAEA 516

  Fly   443 SSTSTSSTTTMTATVTT 459
            .:.:..:..|..|.|||
Zfish   517 LAANAGALITTPAGVTT 533

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prdm13NP_648032.1 COG5048 280..>380 CDD:227381 16/61 (26%)
C2H2 Zn finger 323..343 CDD:275368 4/19 (21%)
zf-H2C2_2 336..358 CDD:290200 10/21 (48%)
C2H2 Zn finger 351..371 CDD:275368 5/19 (26%)
zf-C2H2 406..427 CDD:278523 6/22 (27%)
C2H2 Zn finger 408..427 CDD:275368 4/18 (22%)
zfp91XP_021326898.1 zf-C2H2_8 368..445 CDD:318181 3/20 (15%)
C2H2 Zn finger 402..421 CDD:275368
C2H2 Zn finger 429..449 CDD:275368 4/19 (21%)
zf-C2H2 456..477 CDD:306579 5/20 (25%)
C2H2 Zn finger 457..477 CDD:275368 5/19 (26%)
C2H2 Zn finger 487..503 CDD:275368 4/23 (17%)
Amelogenin <633..>716 CDD:330537
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.