DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prdm13 and pzg

DIOPT Version :9

Sequence 1:NP_648032.1 Gene:Prdm13 / 38713 FlyBaseID:FBgn0035687 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_001262143.1 Gene:pzg / 40351 FlyBaseID:FBgn0259785 Length:996 Species:Drosophila melanogaster


Alignment Length:483 Identity:84/483 - (17%)
Similarity:136/483 - (28%) Gaps:209/483 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 SLEQKRSASLIFRIEQLLPSTSITPTSMTTSSTETTLTATTSTASPAKRMRMSNPRPGVYASQYT 73
            |||:..||.|: |..:||....:..:.:...:|::::..|.:....|.:         :|     
  Fly   190 SLEESPSADLL-RPRKLLQGNPVGQSKIAPGTTQSSVQGTQTVQRKATK---------IY----- 239

  Fly    74 PKDTCSMAIPTSALLGSTVMPTDGSRSHCQLSNGELIVSGSLLRQIKLSEDVYSFNAIFELHGGQ 138
               .|:..              |...|..:|.|...........|.|....::.       |.|.
  Fly   240 ---KCTSC--------------DYKTSDMRLFNTHYETCKQQTFQCKTCRKIFP-------HFGA 280

  Fly   139 VRVRLVRD--VAREDEIVAWFGEELVLLMGIPFLTPLNIQGNSRYMCHLCHLTFETPHPLKIHLA 201
            ::..:|||  .|.::                              .|.:||:.|...:.|     
  Fly   281 MKQHMVRDHNTAMDN------------------------------TCAMCHINFVNENSL----- 310

  Fly   202 LGCGRSAMDILWMRLHYALKAAARSHTETQHSPIPATSSTSSASPTHSPPPQMPPRFSAFRPIAA 266
                                   |.|.||.|:.....:||:                        
  Fly   311 -----------------------RKHMETNHATNVLVTSTT------------------------ 328

  Fly   267 LTQSLPMVPVTTAATPLSYLPSMSMATAPLSTNPMNAAAQIEAIVSN---MGASKQGHLCIYCGK 328
                                      |.|.|..|:.|||...|..:|   :|.|.  :.|.:|..
  Fly   329 --------------------------TIPASAAPVAAAAAAAAAAANENLVGTSL--YTCNHCQF 365

  Fly   329 VYSRKYGLKIHIRTHTGF--KPLKCKFCLRPFGDPSNLNKHVRLHLQTHPSSSAGVADGGASGAD 391
            ..:.|.....|:|.|...  ||.||:.|.:.|........|.:.| ||:                
  Fly   366 KSTDKVVFDEHMRKHAAGKPKPFKCRLCSQRFETREAATVHAKQH-QTN---------------- 413

  Fly   392 MDGDVDIEGETDADYQCHVCHKSFPRRRDLQRHMETRHGGHHSHSHS------------------ 438
                         .::|..|..:||:|..|.:|.|.    |.|.|.|                  
  Fly   414 -------------FFKCGTCSMTFPKREMLVKHFEV----HQSPSASTVSPKQSVSQNLNTQKLL 461

  Fly   439 -ESRSSSTSTSSTTTMTATVTTSTSKSS 465
             |:...:.|.|...:..|.|.|:.|:::
  Fly   462 QETIDEALSDSLPASTAAVVATTESENN 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prdm13NP_648032.1 COG5048 280..>380 CDD:227381 27/104 (26%)
C2H2 Zn finger 323..343 CDD:275368 5/19 (26%)
zf-H2C2_2 336..358 CDD:290200 8/23 (35%)
C2H2 Zn finger 351..371 CDD:275368 4/19 (21%)
zf-C2H2 406..427 CDD:278523 7/20 (35%)
C2H2 Zn finger 408..427 CDD:275368 7/18 (39%)
pzgNP_001262143.1 C2H2 Zn finger 241..263 CDD:275371 5/35 (14%)
C2H2 Zn finger 268..289 CDD:275371 5/27 (19%)
C2H2 Zn finger 297..318 CDD:275371 9/48 (19%)
C2H2 Zn finger 360..380 CDD:275368 5/19 (26%)
zf-H2C2_2 373..399 CDD:290200 9/25 (36%)
zf-C2H2_8 375..443 CDD:292531 24/101 (24%)
C2H2 Zn finger 390..410 CDD:275368 4/19 (21%)
C2H2 Zn finger 417..437 CDD:275368 8/23 (35%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.