DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prdm13 and CG7368

DIOPT Version :9

Sequence 1:NP_648032.1 Gene:Prdm13 / 38713 FlyBaseID:FBgn0035687 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_001036599.1 Gene:CG7368 / 39301 FlyBaseID:FBgn0036179 Length:530 Species:Drosophila melanogaster


Alignment Length:388 Identity:72/388 - (18%)
Similarity:116/388 - (29%) Gaps:166/388 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 EQLLPSTS---ITPTSMTTSSTETTLTATT----------STASPAKRMRMSN--------PRPG 66
            :|:|.:||   :|| ..|.:...:.|.|.|          .:|...|:....|        |..|
  Fly   176 QQVLQNTSWQTLTP-GTTVADYLSHLPANTLPLSLHHFLKYSAETIKKENQQNVVLQVQTGPAIG 239

  Fly    67 V------------YASQYT--PKDTCSMAIPTSALLGSTVMPTDGSRSHCQLSNGELIVSGSLLR 117
            :            .|.|.|  |:...::.:.|.|.:.:|     .:.:....:.|....||...:
  Fly   240 INTLGTTTISIPQQAEQLTLQPQQQATLQVQTQAAVTAT-----ATTATATTAGGSGATSGKKKK 299

  Fly   118 QIKLSEDVYSFNAIFELHGGQVRVRLVRDVAREDEIVAWFGEELVLLMGIPFLTPLNIQGNSRYM 182
            :.|.|:|..:     :|..|::|:....|                              |:..||
  Fly   300 RKKRSKDRKT-----KLRPGEIRLGTALD------------------------------GSPLYM 329

  Fly   183 CHLCHLTFETPHPLKIHLALGCG---RSAMDILWMRLHYALKAAARSHTETQHSPIPATSSTSSA 244
            |..||:.:..|..|::|| :|..   |...||....|       .|....|:|            
  Fly   330 CPECHVAYPEPELLEVHL-VGHNLEKRYVCDICQASL-------KRKDHLTRH------------ 374

  Fly   245 SPTHSPPPQMPPRFSAFRPIAALTQSLPMVPVTTAATPLSYLPSMSMATAPLSTNPMNAAAQIEA 309
            ..:|:|.          ||                                              
  Fly   375 KQSHNPE----------RP---------------------------------------------- 383

  Fly   310 IVSNMGASKQGHLCIYCGKVYSRKYGLKIHIRTHTGFKPLKCKFCLRPFGDPSNLNKHVRLHL 372
                       ::|..|.|.:.||..|.:|...|:|.|..:|..|.:.|....:|.||.|.|:
  Fly   384 -----------YICTVCLKAFKRKEQLSLHFVIHSGEKRHQCGECGKGFYRKDHLRKHTRSHI 435

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prdm13NP_648032.1 COG5048 280..>380 CDD:227381 18/93 (19%)
C2H2 Zn finger 323..343 CDD:275368 7/19 (37%)
zf-H2C2_2 336..358 CDD:290200 7/21 (33%)
C2H2 Zn finger 351..371 CDD:275368 7/19 (37%)
zf-C2H2 406..427 CDD:278523
C2H2 Zn finger 408..427 CDD:275368
CG7368NP_001036599.1 C2H2 Zn finger 330..350 CDD:275368 7/20 (35%)
COG5048 356..>412 CDD:227381 20/141 (14%)
C2H2 Zn finger 358..378 CDD:275368 6/38 (16%)
zf-H2C2_2 370..395 CDD:290200 9/103 (9%)
C2H2 Zn finger 386..406 CDD:275368 7/19 (37%)
zf-H2C2_2 399..423 CDD:290200 8/23 (35%)
zf-C2H2 412..434 CDD:278523 7/21 (33%)
C2H2 Zn finger 414..434 CDD:275368 7/19 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.