DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prdm13 and CG15073

DIOPT Version :9

Sequence 1:NP_648032.1 Gene:Prdm13 / 38713 FlyBaseID:FBgn0035687 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_611362.2 Gene:CG15073 / 37155 FlyBaseID:FBgn0034379 Length:580 Species:Drosophila melanogaster


Alignment Length:382 Identity:72/382 - (18%)
Similarity:113/382 - (29%) Gaps:152/382 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 IQGNSRYMCHLCHLTFET-----PHPLKIH----LALGCGRSAMDILWMRLH------------- 217
            |..:.|..|.:||...||     .|.|:.|    .|:.|.:......::..|             
  Fly   231 ISAHMRLTCDVCHEGQETFLLLCKHMLQEHHRKGYAICCNKKFYKRSFLTDHIDRHADPEKFKCT 295

  Fly   218 -----YALKAAARSHTETQHSPIPATSSTSSASPTHSPPPQMPPRFSAFRPIAALTQSLPMVPVT 277
                 :|.|...|:|...:|.|....:....         |.|.|::.                 
  Fly   296 QCDKRFADKQCLRNHELLKHHPEEEKTFMCE---------QCPKRYTK----------------- 334

  Fly   278 TAATPLSYL----------------------PSMSMATAPLSTNPMNAAAQIEAIVSNMGASKQG 320
                  .||                      |:.|:    |.|:            ..|.....|
  Fly   335 ------QYLLDQHRVIHKERNVVCDLCERRFPNQSL----LCTH------------VKMAHGNYG 377

  Fly   321 HLCIYCGKVYSRKYGLKIHIRTHTGF-KP-LKCKFCLRPFGDPSNLNKHVRLHLQTHPSSSAGVA 383
            .:|..|.:|...:...:.|...|.|. :| ::|..|.....:..:|.||||.|            
  Fly   378 TMCDICAQVIRGRAAFQRHQLEHAGVTEPKVQCDICGSWHKNKHSLKKHVRRH------------ 430

  Fly   384 DGGASGADMDGDVDIEGE-----------TDADYQCHVCHKSFPRRRDLQRHMETRHGGH----- 432
            :|.|:..|:.|.|.....           ||..::|.||:|:|.:...|:.|| |.|.|.     
  Fly   431 NGTAATCDLCGKVSPNRSAMLSHQRYVHLTDRKHECSVCNKAFKKAITLREHM-TMHTGEVLYKC 494

  Fly   433 -----------HSHSH---------SESRSSST----STSSTTTMTATVTTSTSKSS 465
                       :.|:|         .|:|.:.|    :....|....|::|.....|
  Fly   495 PHCPKTFNSNANQHTHRRKCHPKEFEEARKARTEKRKAIEEETPSVLTISTGEDGES 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prdm13NP_648032.1 COG5048 280..>380 CDD:227381 23/123 (19%)
C2H2 Zn finger 323..343 CDD:275368 4/19 (21%)
zf-H2C2_2 336..358 CDD:290200 6/23 (26%)
C2H2 Zn finger 351..371 CDD:275368 7/19 (37%)
zf-C2H2 406..427 CDD:278523 8/20 (40%)
C2H2 Zn finger 408..427 CDD:275368 8/18 (44%)
CG15073NP_611362.2 zf-AD 2..78 CDD:285071
C2H2 Zn finger 269..286 CDD:275368 2/16 (13%)
C2H2 Zn finger 294..316 CDD:275368 4/21 (19%)
C2H2 Zn finger 325..345 CDD:275368 5/51 (10%)
C2H2 Zn finger 352..370 CDD:275368 4/33 (12%)
C2H2 Zn finger 410..430 CDD:275368 7/19 (37%)
C2H2 Zn finger 437..458 CDD:275368 3/20 (15%)
C2H2 Zn finger 466..486 CDD:275368 9/20 (45%)
C2H2 Zn finger 494..512 CDD:275368 2/17 (12%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.