DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prdm13 and fezf-1

DIOPT Version :9

Sequence 1:NP_648032.1 Gene:Prdm13 / 38713 FlyBaseID:FBgn0035687 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_502594.2 Gene:fezf-1 / 3564888 WormBaseID:WBGene00012639 Length:218 Species:Caenorhabditis elegans


Alignment Length:133 Identity:34/133 - (25%)
Similarity:45/133 - (33%) Gaps:49/133 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   321 HLCIYCGKVYSRKYGLKIHIRTHTGFKPLKCKFCLRPFGDPSNLNKH------------------ 367
            |.|..|||.::|...|..|:|.|.||||..|:.|.:.|....|...|                  
 Worm   108 HKCKTCGKCFNRSSTLNTHVRIHQGFKPFVCEICGKGFHQNGNYKNHRLTHEDTKKFSCSICSRA 172

  Fly   368 ------VRLHLQTHPSSSAGVADGGASGADMDGDVDIEGETDADYQCHVCHKSFPRRRDLQRHME 426
                  :..|:.||                         |....:.||||.|.|.|..||::|:.
 Worm   173 FHQSYNLAFHMFTH-------------------------EEHKPFTCHVCSKGFCRNFDLKKHLR
 212

  Fly   427 TRH 429
            ..|
 Worm   213 KMH 215

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prdm13NP_648032.1 COG5048 280..>380 CDD:227381 22/82 (27%)
C2H2 Zn finger 323..343 CDD:275368 8/19 (42%)
zf-H2C2_2 336..358 CDD:290200 10/21 (48%)
C2H2 Zn finger 351..371 CDD:275368 5/43 (12%)
zf-C2H2 406..427 CDD:278523 10/20 (50%)
C2H2 Zn finger 408..427 CDD:275368 10/18 (56%)
fezf-1NP_502594.2 COG5048 <13..212 CDD:227381 33/128 (26%)
DUF3449 <50..>70 CDD:288759
C2H2 Zn finger 54..74 CDD:275368
zf-H2C2_2 66..91 CDD:290200
C2H2 Zn finger 82..102 CDD:275368
C2H2 Zn finger 110..130 CDD:275368 8/19 (42%)
C2H2 Zn finger 138..158 CDD:275368 5/19 (26%)
C2H2 Zn finger 166..186 CDD:275368 1/19 (5%)
C2H2 Zn finger 194..212 CDD:275368 10/17 (59%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.