DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prdm13 and si:dkeyp-84f3.5

DIOPT Version :9

Sequence 1:NP_648032.1 Gene:Prdm13 / 38713 FlyBaseID:FBgn0035687 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_001313282.1 Gene:si:dkeyp-84f3.5 / 334144 ZFINID:ZDB-GENE-050208-162 Length:580 Species:Danio rerio


Alignment Length:170 Identity:43/170 - (25%)
Similarity:64/170 - (37%) Gaps:44/170 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly   297 STNPMNAAAQIEAIVSNMGASKQGHLCIYCGKVYSRKYGLKIHIRTHTGFKPLKCKFCLRPFGDP 361
            |..|..|..|...::.:|.|.:...|.    :|..:....:|:..|:|| |...||.|.|.|...
Zfish   307 SVLPAKAKQQYHGVMRHMVAKQHKQLL----RVNIKGKPKRINRATYTG-KLFSCKHCHRVFVHS 366

  Fly   362 SNLNKHVRLHLQTHPSSSAGVADGGASGADMDGDVDIEGETDADYQCHVCHKSFPRRRDLQRHME 426
            |:|::|:|.|..|.                              :.|..|.:.||:|.|:.||:.
Zfish   367 SSLSRHMRYHKGTL------------------------------HACVYCGRHFPQRCDVTRHVA 401

  Fly   427 TRHGGHHSHSHSESRSSSTSTSST------TTMTATVTTS 460
            ..|.   |...|:|:..||....|      ....:|.|||
Zfish   402 MYHA---SELQSKSQEESTMEHETGNGEQEPMKESTQTTS 438

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prdm13NP_648032.1 COG5048 280..>380 CDD:227381 24/82 (29%)
C2H2 Zn finger 323..343 CDD:275368 2/19 (11%)
zf-H2C2_2 336..358 CDD:290200 9/21 (43%)
C2H2 Zn finger 351..371 CDD:275368 9/19 (47%)
zf-C2H2 406..427 CDD:278523 8/20 (40%)
C2H2 Zn finger 408..427 CDD:275368 8/18 (44%)
si:dkeyp-84f3.5NP_001313282.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.