DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prdm13 and erm

DIOPT Version :9

Sequence 1:NP_648032.1 Gene:Prdm13 / 38713 FlyBaseID:FBgn0035687 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_001259891.2 Gene:erm / 326152 FlyBaseID:FBgn0031375 Length:698 Species:Drosophila melanogaster


Alignment Length:570 Identity:117/570 - (20%)
Similarity:179/570 - (31%) Gaps:191/570 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 QLDSLEQKRSASLIFRIEQLL---------PSTSITPTSMTTS----STETTLTATTS-TASPAK 56
            |.|....||:..|.|.|.:::         |.....|.|..|:    ..:..:.|.:. :.||.:
  Fly    44 QQDEQSAKRACPLKFSIAKIMEPDHRPSQVPPPQPAPVSFATNDDDEDEDPEIDADSERSCSPIE 108

  Fly    57 RMRM-SNPRPGVYAS---QYTPKD----TCSMAIPTSALLGSTVMPTDGSRSHCQLSNGELIV-- 111
            .:.: .:|....|.|   :|.|..    |.|:|.|.|.   :.|.....||....||...|:.  
  Fly   109 VISLDQSPSTVNYDSAFKKYVPGPCSGATSSVASPPST---AAVQQFVSSRHQELLSQYPLLYYA 170

  Fly   112 -------------------SGSLLRQIKLSEDVYSFNAIFELHGGQ-VRVRLVRDVAREDEIVAW 156
                               ..||.....||....|.||  .||..| :|..|...:|....:.| 
  Fly   171 PNQLMCAAAAAQYAALTAQQQSLASAAHLSSFTASLNA--SLHHSQSLRRNLGHPLAAAAAVAA- 232

  Fly   157 FGEELVLLMGIPFLTPLNIQGNSRYMCHLCHLTFETPHPLKIHLALGCGRSAMDILWMRLHYALK 221
                               ...|:.:.:|.|...::|...:...:.|            |...||
  Fly   233 -------------------VAQSQAVPNLQHTLEKSPVAQRTAQSSG------------LQANLK 266

  Fly   222 AAARSHTETQHSPIPATSSTS-SASPTHSPPPQ--------------MPPRFS------AFRPIA 265
            .......:.:.:|.||:::|| :.:.:.||.||              .|..||      .|....
  Fly   267 RKRSPQDQGEVTPPPASTATSATGARSRSPSPQGSIEDSSPGSASGGKPKTFSCLECGKVFNAHY 331

  Fly   266 ALTQSLPMVPVTTAATPLSYLPSMSMATAPLSTNPMNAAAQI--EAIVSNMGASKQGHLCIYCGK 328
            .||:.:   ||.|.|.|.         ...:.......|:.:  ..|:.   .|::.|.|..|||
  Fly   332 NLTRHM---PVHTGARPF---------VCKVCGKGFRQASTLCRHKIIH---TSEKPHKCQTCGK 381

  Fly   329 VYSRKYGLKIHIRTHTGFKPLKCKFCLRPFGDPSNLNKH------------------------VR 369
            .::|...|..|.|.|.|:||..|::|.:.|....|...|                        :.
  Fly   382 AFNRSSTLNTHSRIHAGYKPFVCEYCGKGFHQKGNYKNHKLTHSGEKAYKCNICNKAFHQVYNLT 446

  Fly   370 LHLQTHPSSSAGVADGGASGADMDGDVDIEGETDADYQCHVCHKSFPRRRDLQRHMETRH--GG- 431
            .|:.||....                         .|.|.||.|.|.|..||::||...|  || 
  Fly   447 FHMHTHNDKK-------------------------PYTCRVCAKGFCRNFDLKKHMRKLHEIGGD 486

  Fly   432 ------------HHSHSHSESRSSS--------TSTSSTTTMTATVTTST 461
                        ...::..|..:|.        |..||:.:|:..:..:|
  Fly   487 LDDLDMPPTYDRRREYTRREPLASGYGQASGQLTPDSSSGSMSPPINVTT 536

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prdm13NP_648032.1 COG5048 280..>380 CDD:227381 26/125 (21%)
C2H2 Zn finger 323..343 CDD:275368 8/19 (42%)
zf-H2C2_2 336..358 CDD:290200 9/21 (43%)
C2H2 Zn finger 351..371 CDD:275368 5/43 (12%)
zf-C2H2 406..427 CDD:278523 11/20 (55%)
C2H2 Zn finger 408..427 CDD:275368 10/18 (56%)
ermNP_001259891.2 COG5048 <295..461 CDD:227381 40/205 (20%)
C2H2 Zn finger 320..340 CDD:275368 4/22 (18%)
zf-H2C2_2 332..357 CDD:290200 7/36 (19%)
zf-C2H2 346..368 CDD:278523 2/30 (7%)
C2H2 Zn finger 348..368 CDD:275368 2/19 (11%)
zf-H2C2_2 363..385 CDD:290200 7/24 (29%)
C2H2 Zn finger 376..396 CDD:275368 8/19 (42%)
zf-H2C2_2 389..413 CDD:290200 10/23 (43%)
C2H2 Zn finger 404..424 CDD:275368 5/19 (26%)
zf-H2C2_2 416..441 CDD:290200 2/24 (8%)
C2H2 Zn finger 432..452 CDD:275368 1/19 (5%)
C2H2 Zn finger 460..478 CDD:275368 9/17 (53%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45447766
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.