DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prdm13 and Zfp407

DIOPT Version :9

Sequence 1:NP_648032.1 Gene:Prdm13 / 38713 FlyBaseID:FBgn0035687 Length:465 Species:Drosophila melanogaster
Sequence 2:XP_008770443.2 Gene:Zfp407 / 307213 RGDID:1310645 Length:2255 Species:Rattus norvegicus


Alignment Length:407 Identity:78/407 - (19%)
Similarity:129/407 - (31%) Gaps:161/407 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    99 RSHCQLSNGELIVSGSLLRQIKLSED--------------------------VYSFNAIFELHGG 137
            :::..|.:.|::::.....::.|.||                          :|||        |
  Rat  1288 QANSNLESKEILMNSQHEPEVILEEDAPASIGTAENNDAYETIISIDDKGQTMYSF--------G 1344

  Fly   138 QVRVRLVRDVAREDEIVAWFGEELVLLMGIPFLTPL----------NIQGNS-----RYMCHLCH 187
            :....::|....:.|:|....|.|::..|.....||          .::|:|     |..|..|.
  Rat  1345 RFDSSIIRIKTEDGELVEQPEEGLMVTGGKVSELPLKDCAQGLKKKKVEGSSFGESTRIRCDDCG 1409

  Fly   188 LTFETPHPLKIHLA------------LGCGRSAMDILWMRLHYALKAAARSHTETQHSPIPATSS 240
            ...:....|.:|:|            |.||:|.  .....||..|  |:..|...:.:.:     
  Rat  1410 FLADGLSGLNVHIAMKHPTKEKHFHCLLCGKSF--YTESNLHQHL--ASAGHMRNEQASV----- 1465

  Fly   241 TSSASPTHSPPPQMPPRFSAFRPIAALTQSLPMVPVTTAATPLSYLPSMSMATAPLSTNP---MN 302
                       .::|...:.|:.:                          ..|.|..:..   ::
  Rat  1466 -----------EELPEGGATFKCV--------------------------KCTEPFDSEQNLFLH 1493

  Fly   303 AAAQIEAIVSNMG--------------ASKQGHLCIYCGKV--YSRKYGLKIHIRTHTGFKPLKC 351
            ...|.|.::..:.              ...||::|.||||:  .|.......|||||||.||.||
  Rat  1494 IKGQHEELLREVNKYIVEDTEQINREREENQGNVCKYCGKMCRSSNSMAFLAHIRTHTGSKPFKC 1558

  Fly   352 KFC---LRPFGDPSNLNKHVRLHLQTHPSSSAGVADGGASGADMDGDVDIEGETDADYQCHVCHK 413
            |.|   ....||..|   ||:.||...                             :|:||||..
  Rat  1559 KICHFATAQLGDARN---HVKRHLGMR-----------------------------EYKCHVCGV 1591

  Fly   414 SFPRRRDLQRHMETRHG 430
            :|..::.|..|:..:||
  Rat  1592 AFVMKKHLNTHLLGKHG 1608

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prdm13NP_648032.1 COG5048 280..>380 CDD:227381 32/121 (26%)
C2H2 Zn finger 323..343 CDD:275368 9/21 (43%)
zf-H2C2_2 336..358 CDD:290200 13/24 (54%)
C2H2 Zn finger 351..371 CDD:275368 8/22 (36%)
zf-C2H2 406..427 CDD:278523 8/20 (40%)
C2H2 Zn finger 408..427 CDD:275368 7/18 (39%)
Zfp407XP_008770443.2 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24403
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.