DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment Prdm13 and Zfp91

DIOPT Version :9

Sequence 1:	NP_648032.1	Gene:	Prdm13 / 38713	FlyBaseID:	FBgn0035687	Length:	465	Species:	Drosophila melanogaster
Sequence 2:	NP_001162591.1	Gene:	Zfp91 / 246282	RGDID:	628736	Length:	568	Species:	Rattus norvegicus

Alignment Length:	114	Identity:	26/114 - (22%)
Similarity:	47/114 - (41%)	Gaps:	31/114 - (27%)

- Green bases have known domain annotations that are detailed below.

  Fly   318 KQGHLCIYCGKVYSRKYGLKIHIRTHTGFKPLKCKFCLRPFGDPSNLNKHVRLHLQTHPSSSAGV 382
            ::.::|.||.:.:...:.|.:|...|||.|||:|:.|.......::||.|::.|
  Rat   367 QRDYICEYCARAFKSSHNLAVHRMIHTGEKPLQCEICGFTCRQKASLNWHMKKH----------- 420

  Fly   383 ADGGASGADMDGDVDIEGETDADYQ--CHVCHKSFPRRRDLQRHMETRH 429
                              :.|:.||  |::|.|.|.::..:..|....|
  Rat   421 ------------------DADSFYQFSCNICGKKFEKKDSVVAHKAKSH 451

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
Prdm13	NP_648032.1	COG5048	280..>380	CDD:227381	17/61 (28%)
		C2H2 Zn finger	323..343	CDD:275368	5/19 (26%)
		zf-H2C2_2	336..358	CDD:290200	10/21 (48%)
		C2H2 Zn finger	351..371	CDD:275368	5/19 (26%)
		zf-C2H2	406..427	CDD:278523	7/22 (32%)
		C2H2 Zn finger	408..427	CDD:275368	5/18 (28%)
Zfp91	NP_001162591.1	zf-C2H2_8	311..388	CDD:292531	4/20 (20%)
		C2H2 Zn finger	345..364	CDD:275368
		C2H2 Zn finger	372..392	CDD:275368	5/19 (26%)
		zf-H2C2_2	384..409	CDD:290200	10/24 (42%)
		C2H2 Zn finger	400..420	CDD:275368	5/19 (26%)
		C2H2 Zn finger	430..446	CDD:275368	4/15 (27%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	1	1.100	-	-	O	PTHR24403
Phylome	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	1.100