DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prdm13 and row-1

DIOPT Version :9

Sequence 1:NP_648032.1 Gene:Prdm13 / 38713 FlyBaseID:FBgn0035687 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_001122473.1 Gene:row-1 / 172928 WormBaseID:WBGene00009508 Length:584 Species:Caenorhabditis elegans


Alignment Length:306 Identity:57/306 - (18%)
Similarity:88/306 - (28%) Gaps:129/306 - (42%)


- Green bases have known domain annotations that are detailed below.


  Fly   175 IQGNSRYMCHLCHLTFETPHPLKIHLALGCGRSAMDILWMRLHYALKAAARSHTETQHSPIPATS 239
            |:|  ::||        :.:|.|.:...|.....::.:|                          
 Worm   167 IEG--KFMC--------SYNPTKCYKLCGSVVEVINHIW-------------------------- 195

  Fly   240 STSSASPTHSPPPQMPP----------RFSAFRPIAALTQSLPMVPVTTAATPLSYLPSMSMATA 294
                |...|.||  :||          .||..     |..|........:|..|..|.:.....|
 Worm   196 ----AHVIHDPP--LPPIEKKESKDDGMFSCL-----LRNSDAAQLAENSALSLKRLQTCQFCNA 249

  Fly   295 PLSTNPMNAAAQIEAIVSNMGASKQGHL---CIYCGKVYSRKYGLKIHIRTH-TGFKPLKCKFC- 354
            ...|..:..   |..:..:|   :|.||   |..|...:.....|..|::.| :|..|..|:.| 
 Worm   250 VFRTVHLKT---IHVVKCHM---EQDHLDTTCNICELDFGNSIALNTHMKKHISGEAPYNCQKCK 308

  Fly   355 ----LRPF----------GDPSNL-----------------NKHVRL-----HLQTHPSSSAGVA 383
                :|.|          .|...|                 :||:.:     |:::|        
 Worm   309 YRTSVRAFFYQHFIEKHSNDSRTLLCPICLHHEDLRPNVRRSKHIFVREFVNHMRSH-------- 365

  Fly   384 DGGASGADMDGDVDIEGETDADYQCHVCHKSFPRRRDLQRHMETRH 429
               |.|..|              :||||..:|..|..|:.|....|
 Worm   366 ---ALGPQM--------------RCHVCALTFTSRLLLEAHRTNDH 394

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prdm13NP_648032.1 COG5048 280..>380 CDD:227381 27/140 (19%)
C2H2 Zn finger 323..343 CDD:275368 4/19 (21%)
zf-H2C2_2 336..358 CDD:290200 8/27 (30%)
C2H2 Zn finger 351..371 CDD:275368 8/56 (14%)
zf-C2H2 406..427 CDD:278523 8/20 (40%)
C2H2 Zn finger 408..427 CDD:275368 8/18 (44%)
row-1NP_001122473.1 GAT1 <15..288 CDD:227928 30/173 (17%)
C2H2 Zn finger 244..265 CDD:275368 3/23 (13%)
C2H2 Zn finger 275..295 CDD:275368 4/19 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.