| Sequence 1: | NP_648032.1 | Gene: | Prdm13 / 38713 | FlyBaseID: | FBgn0035687 | Length: | 465 | Species: | Drosophila melanogaster |
|---|---|---|---|---|---|---|---|---|---|
| Sequence 2: | NP_653232.3 | Gene: | ZNF513 / 130557 | HGNCID: | 26498 | Length: | 541 | Species: | Homo sapiens |
| Alignment Length: | 370 | Identity: | 76/370 - (20%) |
|---|---|---|---|
| Similarity: | 106/370 - (28%) | Gaps: | 145/370 - (39%) |
- Green bases have known domain annotations that are detailed below.
|
Fly 166 GIPFLTPLNIQGNSRYMCHLCHLTFETPHPLKIHL-------ALGCGR---SAMDILWMRLHYAL 220
Fly 221 KAAARSHT-----ETQHSPIPATS--STSSASPTHSPPPQMPPRFSAFRPIAALTQSLPMVPVTT 278
Fly 279 AATP-----LSYLPSMSMATAPLSTNPMNAAAQI------------------------------- 307
Fly 308 -EAIVSNMGASKQG------------------------------------HL------------- 322
Fly 323 -CIYCGKVYSRKYGLKIHIRTHTGFKPLKCKFCLRPFGDPSNLNKHVRLHLQTHPSSSAGVADGG 386
Fly 387 ASGADMDGDVDIEGETDADYQCHVCHKSFPRRRDLQRHMETRHGG 431 |
| Gene | Sequence | Domain | Region | External ID | Identity |
|---|---|---|---|---|---|
| Prdm13 | NP_648032.1 | COG5048 | 280..>380 | CDD:227381 | 34/186 (18%) |
| C2H2 Zn finger | 323..343 | CDD:275368 | 6/19 (32%) | ||
| zf-H2C2_2 | 336..358 | CDD:290200 | 12/21 (57%) | ||
| C2H2 Zn finger | 351..371 | CDD:275368 | 7/19 (37%) | ||
| zf-C2H2 | 406..427 | CDD:278523 | 7/20 (35%) | ||
| C2H2 Zn finger | 408..427 | CDD:275368 | 7/18 (39%) | ||
| ZNF513 | NP_653232.3 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..118 | ||
| C2H2 Zn finger | 152..172 | CDD:275368 | 6/19 (32%) | ||
| COG5048 | 176..>228 | CDD:227381 | 10/57 (18%) | ||
| C2H2 Zn finger | 180..200 | CDD:275368 | 5/25 (20%) | ||
| zf-H2C2_2 | 192..217 | CDD:316026 | 6/30 (20%) | ||
| C2H2 Zn finger | 208..228 | CDD:275368 | 3/19 (16%) | ||
| C2H2 Zn finger | 362..382 | CDD:275368 | 2/19 (11%) | ||
| COG5048 | <372..>450 | CDD:227381 | 26/106 (25%) | ||
| C2H2 Zn finger | 390..410 | CDD:275368 | 6/19 (32%) | ||
| COG5048 | 414..>487 | CDD:227381 | 24/85 (28%) | ||
| C2H2 Zn finger | 418..438 | CDD:275368 | 7/19 (37%) | ||
| C2H2 Zn finger | 446..466 | CDD:275368 | 7/20 (35%) | ||
| C2H2 Zn finger | 474..493 | CDD:275368 | |||
| Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 492..541 | ||||
| Blue background indicates that the domain is not in the aligned region. | |||||
| Tool | Simple Score | Weighted Score | Original Tool Information | |||
|---|---|---|---|---|---|---|
| BLAST Result | Score | Score Type | Cluster ID | |||
| Compara | 0 | 0.000 | Not matched by this tool. | |||
| Domainoid | 0 | 0.000 | Not matched by this tool. | |||
| eggNOG | 0 | 0.000 | Not matched by this tool. | |||
| Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
| Homologene | 0 | 0.000 | Not matched by this tool. | |||
| Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
| Isobase | 0 | 0.000 | Not matched by this tool. | |||
| OMA | 0 | 0.000 | Not matched by this tool. | |||
| OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
| OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
| OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
| orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
| Panther | 1 | 1.100 | - | - | O | PTHR24403 |
| Phylome | 0 | 0.000 | Not matched by this tool. | |||
| RoundUp | 0 | 0.000 | Not matched by this tool. | |||
| SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
| SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
| TreeFam | 0 | 0.000 | Not matched by this tool. | |||
| User_Submission | 0 | 0.000 | Not matched by this tool. | |||
| 1 | 1.100 | |||||