DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prdm13 and Zfp91

DIOPT Version :9

Sequence 1:NP_648032.1 Gene:Prdm13 / 38713 FlyBaseID:FBgn0035687 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_443735.2 Gene:Zfp91 / 109910 MGIID:104854 Length:572 Species:Mus musculus


Alignment Length:498 Identity:83/498 - (16%)
Similarity:149/498 - (29%) Gaps:162/498 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 EQLLPSTSITPT--SMTTSST---------ETTLTATTSTASPAKRMRMSNPR------------ 64
            |:|.|..:..|.  :.|.||.         .|...|..:.|:.::|.:...||            
Mouse    29 EELRPGAAAAPAAPAETASSRVLRGGRDRGRTAAAAAAAAAAVSRRRKAEYPRRRRSSPSNRPPD 93

  Fly    65 -----------PGVYASQYTPKDTCSMAI-----PTSALLGSTVMPTDGSRSHCQLSNGELIVSG 113
                       |.....:.:|:..|...:     |.......:|:|.:.|.:..:.|......|.
Mouse    94 GPGHQPAAAKPPSPAQGKKSPRLQCIEKLTTDKDPKEEKEDDSVLPQEVSITTTRASRSWRSSSR 158

  Fly   114 SLLRQIKLSEDVYSFNA---------------------IFELH---GGQVRVRLVRDVAREDEIV 154
            :.:.:::.||:..|..:                     :.|.|   ||     :..|...|:|..
Mouse   159 TSISRLRDSENTRSSRSKTGSLQLVCKTEPITDQLDYDVPEEHQSPGG-----ISSDEEEEEEEE 218

  Fly   155 AWFGEELVLLMGIPFLTPLNIQGNSRYMCHLCHLTFETPHPLKIHLALGCGRSAMDILWMRLHYA 219
            ....||     .|||      :.:.|...:..||..|||.|         .|.:..:...:....
Mouse   219 MLISEE-----EIPF------KDDPRDETYKPHLERETPKP---------RRKSGKVKEEKEKKE 263

  Fly   220 LKAAARSHTETQHSPIPATSSTSSASPTHSPPPQMPPRFSAFRPIAALTQSLPMVPVTTAATPLS 284
            :|.......:.:.:.|              ...:.|||....|   ......|.:|......|:.
Mouse   264 IKVEVEVEVKEEENEI--------------REDEEPPRKRGRR---RKDDKSPRLPKRRKKPPIQ 311

  Fly   285 YLPSMSMATAPLSTNPMNAAAQIE--------------------------AIVSNMGASKQGHLC 323
            |:.........:..:|......|:                          ...:.....::.::|
Mouse   312 YVRCEMEGCGTVLAHPRYLQHHIKYQHLLKKKYVCPHPSCGRLFRLQKQLLRHAKHHTDQRDYIC 376

  Fly   324 IYCGKVYSRKYGLKIHIRTHTGFKPLKCKFCLRPFGDPSNLNKHVRLHLQTHPSSSAGVADGGAS 388
            .||.:.:...:.|.:|...|||.|||:|:.|.......::||.|::.|                 
Mouse   377 EYCARAFKSSHNLAVHRMIHTGEKPLQCEICGFTCRQKASLNWHMKKH----------------- 424

  Fly   389 GADMDGDVDIEGETDADYQ--CHVCHKSFPRRRDLQRHMETRH 429
                        :.|:.||  |::|.|.|.::..:..|....|
Mouse   425 ------------DADSFYQFSCNICGKKFEKKDSVVAHKAKSH 455

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prdm13NP_648032.1 COG5048 280..>380 CDD:227381 21/125 (17%)
C2H2 Zn finger 323..343 CDD:275368 5/19 (26%)
zf-H2C2_2 336..358 CDD:290200 10/21 (48%)
C2H2 Zn finger 351..371 CDD:275368 5/19 (26%)
zf-C2H2 406..427 CDD:278523 7/22 (32%)
C2H2 Zn finger 408..427 CDD:275368 5/18 (28%)
Zfp91NP_443735.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..308 53/320 (17%)
zf-C2H2_8 315..392 CDD:292531 6/76 (8%)
Interaction with MAP3K14/NIK. /evidence=ECO:0000250 340..370 0/29 (0%)
C2H2 Zn finger 349..368 CDD:275368 0/18 (0%)
C2H2 Zn finger 376..396 CDD:275368 5/19 (26%)
zf-H2C2_2 388..413 CDD:290200 10/24 (42%)
C2H2 Zn finger 404..424 CDD:275368 5/19 (26%)
C2H2 Zn finger 434..450 CDD:275368 4/15 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.