DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Prdm13 and zfp64

DIOPT Version :9

Sequence 1:NP_648032.1 Gene:Prdm13 / 38713 FlyBaseID:FBgn0035687 Length:465 Species:Drosophila melanogaster
Sequence 2:NP_001373446.1 Gene:zfp64 / 100003733 ZFINID:ZDB-GENE-031118-80 Length:642 Species:Danio rerio


Alignment Length:549 Identity:105/549 - (19%)
Similarity:161/549 - (29%) Gaps:205/549 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    11 EQKRSASLIFRIEQ---LLPSTSIT------PTSMTTSSTETTLTATTSTASPAKRMRMSNPRPG 66
            :|..:..|.|..:|   .:|||.|:      ..|:.|..::...|.|.:..:|:|::     :|.
Zfish    28 QQYNNVELFFAHKQNCCQIPSTHISVRNAGASESLQTCVSKVKKTLTKAQKNPSKKL-----KPA 87

  Fly    67 V-------------YASQYTPKDTCSMAIPTSALLGSTVMPTDGSRS------------------ 100
            :             :.:||..||           :...::...|.|.                  
Zfish    88 LTQKRHICTFSGCTFKTQYGQKD-----------MERHILTHTGERPFECELCHKRFSRRDKLNL 141

  Fly   101 HCQLSNGE-----------LIVSGSLLRQIKLSEDVYSFNA----IFELHGGQVRVRLVRDVARE 150
            |.:|..||           ...|.||.:.:::..|...|..    ....:..|:.|.|       
Zfish   142 HSRLHTGEKPHKCKYCTYAAADSSSLKKHLRIHYDERPFKCQICPYASRNSSQLTVHL------- 199

  Fly   151 DEIVAWFGEELVLLMGIPFLTPLNIQGNSRYMCHLCHLTFETPHPLKIHLALGCGRSAMDILWMR 215
                                  .:..|::.:.|:.|...|:....||.|..:..|..........
Zfish   200 ----------------------RSHTGDAPFQCNQCDAKFKINSDLKRHSRVHSGEKPYKCDLCD 242

  Fly   216 LHYALKAAARSHTETQHSPIPA--------TSSTSSASPTHSPPPQMPPRFSAFRPIAALTQSLP 272
            ...|:||..:||...:||...:        ..||.:|...||...|                   
Zfish   243 YRCAMKANLKSHVHLKHSASDSFHCSKCDFQCSTKAALRHHSRQHQ------------------- 288

  Fly   273 MVPVTTAATPLSYLPSMSMATAPLSTNPMNAAAQIEAIVSNMGASKQGHLCIYCGKVYSRKYGLK 337
                  .|.||.                                      |..|....|.|..||
Zfish   289 ------PAQPLQ--------------------------------------CSECSYSCSSKGALK 309

  Fly   338 IHIRTHTGFKPLKCKFCLRPFGDPSNLNKHVRLHLQTHPS--SSAGVADGGASGADMDGDVD--- 397
            ||.|.|:..:|.||..|.......|||..|.|......|.  |.:|...|  :|.|:...:.   
Zfish   310 IHERVHSDERPFKCDLCSFASKQRSNLLIHTRKCHADKPDRLSKSGRISG--NGEDLTKPISSRY 372

  Fly   398 -IEGETDADYQCHVCHKSFPRRRDLQRHMETRHGGHHSHSHSESRSSST---------------- 445
             .:.|....|:|.:|..||.|...|:.|....:......||:::..:||                
Zfish   373 RAKLEATRAYRCDLCEASFVREDSLRSHKRQHNNITQQQSHNQTSQTSTKQPVQNIPEASIATES 437

  Fly   446 -STSSTTTMTATVTTS---------TSKS 464
             ||.:||.:...|..|         ||||
Zfish   438 PSTYNTTHLKIIVAPSLGSEASFVQTSKS 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Prdm13NP_648032.1 COG5048 280..>380 CDD:227381 24/101 (24%)
C2H2 Zn finger 323..343 CDD:275368 9/19 (47%)
zf-H2C2_2 336..358 CDD:290200 10/21 (48%)
C2H2 Zn finger 351..371 CDD:275368 7/19 (37%)
zf-C2H2 406..427 CDD:278523 8/20 (40%)
C2H2 Zn finger 408..427 CDD:275368 7/18 (39%)
zfp64NP_001373446.1 C2H2 Zn finger 95..118 CDD:275368 4/33 (12%)
zf-H2C2_2 110..135 CDD:404364 3/35 (9%)
C2H2 Zn finger 126..146 CDD:275368 1/19 (5%)
zf-H2C2_2 139..162 CDD:404364 4/22 (18%)
C2H2 Zn finger 154..174 CDD:275368 3/19 (16%)
SFP1 <176..260 CDD:227516 18/112 (16%)
C2H2 Zn finger 182..202 CDD:275368 3/48 (6%)
C2H2 Zn finger 210..230 CDD:275368 6/19 (32%)
zf-H2C2_2 222..246 CDD:404364 4/23 (17%)
C2H2 Zn finger 238..257 CDD:275368 5/18 (28%)
C2H2 Zn finger 323..341 CDD:275368 6/17 (35%)
C2H2 Zn finger 384..404 CDD:275368 7/19 (37%)
SP1-4_N <408..>605 CDD:425404 14/59 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR24403
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.100

Return to query results.
Submit another query.