DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Az and KALRN

DIOPT Version :9

Sequence 1:NP_648031.1 Gene:Cpr65Az / 38712 FlyBaseID:FBgn0035686 Length:239 Species:Drosophila melanogaster
Sequence 2:XP_006713873.1 Gene:KALRN / 8997 HGNCID:4814 Length:2988 Species:Homo sapiens


Alignment Length:234 Identity:52/234 - (22%)
Similarity:70/234 - (29%) Gaps:80/234 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 VRSQPAGYPSARPPATYLPVKPPAPPPRPPPPAPANSYGPPKKGNGKPPPAPPKPSYGPPPKNGN 81
            :|||||..|.|              .|||....||.|..|||..:..||..|.|.|      ..|
Human  2253 MRSQPARLPQA--------------SPRPYSSVPAGSEKPPKGSSYNPPLPPLKIS------TSN 2297

  Fly    82 GKPPPSNAYLPPGNGNGGSSGGGGAGGGGGEDIPIIKLESKVNTDGSYMYEYETGNGIKAEEMGY 146
            |.  |...|..||:....|......|..|...:.:||             :|   ..:|..|:  
Human  2298 GS--PGFEYHQPGDKFEASKQNDLGGCNGTSSMAVIK-------------DY---YALKENEI-- 2342

  Fly   147 LKNAGVEGAEAQTAEGSFSYTSPEGQEISLTYIADEN---GFQPQGDHLPTPPP-IPIEIQEALD 207
                                ...:|:.:.:..:..:|   .:||..||.|.... :|..|...|.
Human  2343 --------------------CVSQGEVVQVLAVNQQNMCLVYQPASDHSPAAEGWVPGSILAPLT 2387

  Fly   208 KLAAGGGCHG----------------CDDNETGGNDDGG 230
            |..|.....|                .:...||.|:..|
Human  2388 KATAAESSDGSIKKSCSWHTLRMRKRAEVENTGKNEATG 2426

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AzNP_648031.1 Chitin_bind_4 129..185 CDD:278791 5/58 (9%)
KALRNXP_006713873.1 SEC14 41..179 CDD:214706
SPEC 192..412 CDD:238103
SPEC 313..538 CDD:238103
SPEC 539..768 CDD:238103
SPEC 893..1131 CDD:238103
SPEC <1101..1240 CDD:295325
RhoGEF 1286..1456 CDD:238091
PH1_Kalirin_Trio_like 1463..1585 CDD:270060
PH 1496..1581 CDD:278594
SH3_Kalirin_1 1651..1710 CDD:212786
SH3-RhoG_link 1708..1934 CDD:293215
RhoGEF 1935..2105 CDD:279015
PH2_Kalirin_Trio_p63RhoGEF 2109..2243 CDD:270061
PH 2142..2228 CDD:278594
SH3_Kalirin_2 2327..2385 CDD:212787 14/95 (15%)
I-set 2473..2567 CDD:254352
Ig 2490..2564 CDD:143165
FN3 2571..2662 CDD:238020
S_TKc 2686..2940 CDD:214567
STKc_Kalirin_C 2692..2939 CDD:271017
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.