Sequence 1: | NP_648031.1 | Gene: | Cpr65Az / 38712 | FlyBaseID: | FBgn0035686 | Length: | 239 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_006713873.1 | Gene: | KALRN / 8997 | HGNCID: | 4814 | Length: | 2988 | Species: | Homo sapiens |
Alignment Length: | 234 | Identity: | 52/234 - (22%) |
---|---|---|---|
Similarity: | 70/234 - (29%) | Gaps: | 80/234 - (34%) |
- Green bases have known domain annotations that are detailed below.
Fly 17 VRSQPAGYPSARPPATYLPVKPPAPPPRPPPPAPANSYGPPKKGNGKPPPAPPKPSYGPPPKNGN 81
Fly 82 GKPPPSNAYLPPGNGNGGSSGGGGAGGGGGEDIPIIKLESKVNTDGSYMYEYETGNGIKAEEMGY 146
Fly 147 LKNAGVEGAEAQTAEGSFSYTSPEGQEISLTYIADEN---GFQPQGDHLPTPPP-IPIEIQEALD 207
Fly 208 KLAAGGGCHG----------------CDDNETGGNDDGG 230 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Cpr65Az | NP_648031.1 | Chitin_bind_4 | 129..185 | CDD:278791 | 5/58 (9%) |
KALRN | XP_006713873.1 | SEC14 | 41..179 | CDD:214706 | |
SPEC | 192..412 | CDD:238103 | |||
SPEC | 313..538 | CDD:238103 | |||
SPEC | 539..768 | CDD:238103 | |||
SPEC | 893..1131 | CDD:238103 | |||
SPEC | <1101..1240 | CDD:295325 | |||
RhoGEF | 1286..1456 | CDD:238091 | |||
PH1_Kalirin_Trio_like | 1463..1585 | CDD:270060 | |||
PH | 1496..1581 | CDD:278594 | |||
SH3_Kalirin_1 | 1651..1710 | CDD:212786 | |||
SH3-RhoG_link | 1708..1934 | CDD:293215 | |||
RhoGEF | 1935..2105 | CDD:279015 | |||
PH2_Kalirin_Trio_p63RhoGEF | 2109..2243 | CDD:270061 | |||
PH | 2142..2228 | CDD:278594 | |||
SH3_Kalirin_2 | 2327..2385 | CDD:212787 | 14/95 (15%) | ||
I-set | 2473..2567 | CDD:254352 | |||
Ig | 2490..2564 | CDD:143165 | |||
FN3 | 2571..2662 | CDD:238020 | |||
S_TKc | 2686..2940 | CDD:214567 | |||
STKc_Kalirin_C | 2692..2939 | CDD:271017 | |||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
1 | 0.910 |