DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Az and Lcp65Ag3

DIOPT Version :9

Sequence 1:NP_648031.1 Gene:Cpr65Az / 38712 FlyBaseID:FBgn0035686 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_652662.1 Gene:Lcp65Ag3 / 59159 FlyBaseID:FBgn0086611 Length:105 Species:Drosophila melanogaster


Alignment Length:85 Identity:35/85 - (41%)
Similarity:54/85 - (63%) Gaps:2/85 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 EDIPIIKLESKVNTDGSYMYEYETGNGIKAEEMGYLKNAGVEGAEAQTAEGSFSYTSPEGQEISL 176
            |:..|::.||.|..: |:.|::||.:|..|:.:|.|.:.|.|. ||.:..||:.:.:.:||...:
  Fly    21 EEPTIVRSESDVGPE-SFKYDWETSDGQAAQAVGQLNDIGTEN-EAISVSGSYRFIADDGQTYQV 83

  Fly   177 TYIADENGFQPQGDHLPTPP 196
            .||||:|||||:|.|||..|
  Fly    84 NYIADKNGFQPEGAHLPVAP 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AzNP_648031.1 Chitin_bind_4 129..185 CDD:278791 20/55 (36%)
Lcp65Ag3NP_652662.1 Chitin_bind_4 37..92 CDD:278791 20/55 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.