powered by:
Protein Alignment Cpr65Az and CG34461
DIOPT Version :9
Sequence 1: | NP_648031.1 |
Gene: | Cpr65Az / 38712 |
FlyBaseID: | FBgn0035686 |
Length: | 239 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001097547.1 |
Gene: | CG34461 / 5740547 |
FlyBaseID: | FBgn0250833 |
Length: | 138 |
Species: | Drosophila melanogaster |
Alignment Length: | 58 |
Identity: | 18/58 - (31%) |
Similarity: | 28/58 - (48%) |
Gaps: | 6/58 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 129 YMYEYETGNGIKAEEMGYLKNAGVEGAEAQTAEGSFSYTSPEGQEISLTYIADE-NGF 185
|.:.| |||....|.:|:. .|..:....:|.:|...|:|...::.|.||: |||
Fly 52 YSFNY----GIKDPHTGDIKSQ-AEERDGDVVKGQYSLVEPDGSVRTVDYTADDHNGF 104
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.