DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Az and CPR151

DIOPT Version :9

Sequence 1:NP_648031.1 Gene:Cpr65Az / 38712 FlyBaseID:FBgn0035686 Length:239 Species:Drosophila melanogaster
Sequence 2:XP_001238069.3 Gene:CPR151 / 4578144 VectorBaseID:AGAP009870 Length:153 Species:Anopheles gambiae


Alignment Length:99 Identity:42/99 - (42%)
Similarity:63/99 - (63%) Gaps:2/99 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 EDIPIIKLESKVNTDGSYMYEYETGNGIKAEEMGYLKNAGVEGAEAQTAEGSFSYTSPEGQEISL 176
            ::|||:.||:.:..||.:.|.||.|:|.:|.:.|  :...|.......::|.::|...:|:..|:
Mosquito    44 KEIPIVNLENVLEVDGKFRYSYEGGDGTRAAQDG--QQIVVNNQVGTASQGQYTYQGDDGKTYSI 106

  Fly   177 TYIADENGFQPQGDHLPTPPPIPIEIQEALDKLA 210
            :|||||||::|.|||||||||:|..|..||..||
Mosquito   107 SYIADENGYRPVGDHLPTPPPVPAPIARALAHLA 140

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AzNP_648031.1 Chitin_bind_4 129..185 CDD:278791 18/55 (33%)
CPR151XP_001238069.3 Chitin_bind_4 61..115 CDD:278791 18/55 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.