powered by:
Protein Alignment Cpr65Az and Ccp84Ac
DIOPT Version :9
Sequence 1: | NP_648031.1 |
Gene: | Cpr65Az / 38712 |
FlyBaseID: | FBgn0035686 |
Length: | 239 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_649681.1 |
Gene: | Ccp84Ac / 40823 |
FlyBaseID: | FBgn0004781 |
Length: | 217 |
Species: | Drosophila melanogaster |
Alignment Length: | 58 |
Identity: | 13/58 - (22%) |
Similarity: | 25/58 - (43%) |
Gaps: | 6/58 - (10%) |
- Green bases have known domain annotations that are detailed below.
Fly 129 YMYEYETGNGIKAEEMGYLKNAGVEGAEAQTAEGSFSYTSPEGQEISLTYIADE-NGF 185
|.:.|:..:.:..: ..:.||..:....:|.:|....:|...::.|.||. |||
Fly 65 YNFAYDVQDALSGD-----SKSQVESRDGDVVQGEYSLDDADGFRRTVKYTADSVNGF 117
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.