DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Az and Ccp84Ae

DIOPT Version :10

Sequence 1:NP_648031.1 Gene:Cpr65Az / 38712 FlyBaseID:FBgn0035686 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_649679.1 Gene:Ccp84Ae / 40821 FlyBaseID:FBgn0004779 Length:208 Species:Drosophila melanogaster


Alignment Length:103 Identity:26/103 - (25%)
Similarity:46/103 - (44%) Gaps:14/103 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 IPI----IKLESKVNTDGSYMYEYETGNGIKAEEMGYLKNAGVEGAEAQTAEGSFSYTSPEGQEI 174
            :|:    ::|| :|:....|.|.|:..:.:..:..|:     ||..:.....|.:|....:|.:.
  Fly    33 VPVLAKTVELE-EVDPHPQYTYSYDVQDTLSGDNKGH-----VEERDGDVVRGEYSLIDADGFKR 91

  Fly   175 SLTYIADE-NGFQPQGDHLPTPPPIPIEIQEALDKLAA 211
            ::||.||. |||...   :...|...:...|.|.|:||
  Fly    92 TVTYTADSINGFNAV---VRREPLAAVVAAEPLLKVAA 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AzNP_648031.1 Chitin_bind_4 129..185 CDD:459790 14/56 (25%)
Ccp84AeNP_649679.1 Chitin_bind_4 51..103 CDD:459790 14/56 (25%)

Return to query results.
Submit another query.