DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Az and Ccp84Ag

DIOPT Version :10

Sequence 1:NP_648031.1 Gene:Cpr65Az / 38712 FlyBaseID:FBgn0035686 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_649677.1 Gene:Ccp84Ag / 40819 FlyBaseID:FBgn0004777 Length:191 Species:Drosophila melanogaster


Alignment Length:58 Identity:16/58 - (27%)
Similarity:23/58 - (39%) Gaps:6/58 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly   129 YMYEYETGNGIKAEEMGYLKNAGVEGAEAQTAEGSFSYTSPEGQEISLTYIADE-NGF 185
            |.|.|:..:.|..:     ....||..|....:|.:|....:|....:.|.||. |||
  Fly    42 YTYGYDVKDAISGD-----SKTQVETREGDVVQGQYSLNDADGYRRIVDYTADPINGF 94

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AzNP_648031.1 Chitin_bind_4 129..185 CDD:459790 14/56 (25%)
Ccp84AgNP_649677.1 Chitin_bind_4 42..94 CDD:459790 14/56 (25%)

Return to query results.
Submit another query.