DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Az and Cpr76Bb

DIOPT Version :9

Sequence 1:NP_648031.1 Gene:Cpr65Az / 38712 FlyBaseID:FBgn0035686 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_649121.1 Gene:Cpr76Bb / 40121 FlyBaseID:FBgn0036879 Length:198 Species:Drosophila melanogaster


Alignment Length:211 Identity:49/211 - (23%)
Similarity:65/211 - (30%) Gaps:69/211 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PPPAPANSY-------GPPKKGNGKPPPAPPKPSYGPPPKNGNGKPPPSNAYLPPGNGNGGSSGG 103
            |....|.||       ||..|..|.........:||  ...|:|.|               |.|.
  Fly    21 PHGGHATSYSSVTKHEGPVHKSLGYGYDHDVVSAYG--GIYGHGYP---------------SVGH 68

  Fly   104 GGAGGGGGEDIPIIKLESKVNTDGSYMYEYETGNGIKAEEMGYLKNAGVEGAEAQTAEGSFSYTS 168
            .|.|.|..:..|        :....|.::|    |:|....|..|:.. |..:....:||:|...
  Fly    69 SGYGYGYDKHEP--------HHYPKYQFDY----GVKDAHTGDQKSQW-ETRDGDKVKGSYSLKE 120

  Fly   169 PEGQEISLTYIADE-NGF-----------QPQGDHLPTPPPIPIEIQEALDKLAAGGGCHGCDDN 221
            .:|....:.|.||: |||           .||..|                   .|.|.....|.
  Fly   121 SDGTTRVVEYTADDHNGFNAVVKKLGHAHHPQVYH-------------------KGYGHGDIYDA 166

  Fly   222 ETG-GNDDGGGGGYVY 236
            :.| |:|....|||.|
  Fly   167 DYGYGHDVAQYGGYGY 182

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AzNP_648031.1 Chitin_bind_4 129..185 CDD:278791 15/56 (27%)
Cpr76BbNP_649121.1 Chitin_bind_4 86..138 CDD:278791 15/56 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.