DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Az and Cpr49Ae

DIOPT Version :9

Sequence 1:NP_648031.1 Gene:Cpr65Az / 38712 FlyBaseID:FBgn0035686 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_610774.3 Gene:Cpr49Ae / 36351 FlyBaseID:FBgn0033728 Length:134 Species:Drosophila melanogaster


Alignment Length:100 Identity:64/100 - (64%)
Similarity:70/100 - (70%) Gaps:2/100 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 EDIPIIKLESKVNTDGSYMYEYETGNGIKAEEMGYLKNA-GVEGAEAQTAEGSFSYTSPEGQEIS 175
            |.|.||..||.:..||||.|.|||.|||||||.|.||.| ..:.::...|.||.|||||||..|:
  Fly    26 EPIAIISQESNIEPDGSYNYAYETANGIKAEETGTLKKATSPDSSDVIIARGSVSYTSPEGNLIT 90

  Fly   176 LTYIA-DENGFQPQGDHLPTPPPIPIEIQEALDKL 209
            |.|.| |||||||||||||||||||..||:|||.|
  Fly    91 LNYSADDENGFQPQGDHLPTPPPIPPAIQKALDYL 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AzNP_648031.1 Chitin_bind_4 129..185 CDD:278791 33/57 (58%)
Cpr49AeNP_610774.3 Chitin_bind_4 43..101 CDD:278791 33/57 (58%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.