DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Az and Cpr49Ac

DIOPT Version :9

Sequence 1:NP_648031.1 Gene:Cpr65Az / 38712 FlyBaseID:FBgn0035686 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_725150.2 Gene:Cpr49Ac / 36348 FlyBaseID:FBgn0033725 Length:324 Species:Drosophila melanogaster


Alignment Length:247 Identity:56/247 - (22%)
Similarity:73/247 - (29%) Gaps:113/247 - (45%)


- Green bases have known domain annotations that are detailed below.


  Fly    48 PAPANSYGPPKKGNGKPPPAPPKPSYGPPPKNGN-GKPPPSNAYLPPGNG-NGGSSGG------- 103
            |.|.|        |||         |..|.::.| ||..||:.....||. |.|.||.       
  Fly    23 PVPDN--------NGK---------YTVPQQSSNDGKYRPSDDGKYHGNSQNEGRSGSQESIGRY 70

  Fly   104 ---------------------------GGAGGGGGEDIPIIKLESKVNTD--------------- 126
                                       ||.|...|.:||.:..:...|.|               
  Fly    71 HHMPIPYRHVSDQRELGKYHHIPYPYDGGYGPYAGSNIPYVHDDRPYNHDLYTSTTTKKPTTTTK 135

  Fly   127 -------------------------------------GSYMYEYETGNGIKAEEMGYLKNAGVEG 154
                                                 ..|.:.|.|.|||..||...|.:.|   
  Fly   136 RTTTSTTTTTTTPRNILFNYDDEGRHKILHKEEVRKQDKYDHSYLTENGIYGEEQAKLHHTG--- 197

  Fly   155 AEAQTAEGSFSYTSPEGQEISLTYIADENGFQPQGDHLPTPPPIPIEIQEAL 206
              ...|:|.:.||..:|:...:.|.:::.||.|||||:   .|||..|..||
  Fly   198 --GTHAKGFYEYTGDDGKLYRVNYASNDGGFMPQGDHI---HPIPDAIVRAL 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AzNP_648031.1 Chitin_bind_4 129..185 CDD:278791 16/55 (29%)
Cpr49AcNP_725150.2 Chitin_bind_4 175..226 CDD:278791 16/55 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439129
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D146314at6656
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.