DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Az and Cpr49Ab

DIOPT Version :9

Sequence 1:NP_648031.1 Gene:Cpr65Az / 38712 FlyBaseID:FBgn0035686 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_610769.1 Gene:Cpr49Ab / 36345 FlyBaseID:FBgn0050042 Length:259 Species:Drosophila melanogaster


Alignment Length:233 Identity:65/233 - (27%)
Similarity:87/233 - (37%) Gaps:70/233 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 RPPPPAPANSYGPPKKGN-----------------GKPPPAPPKPSYGPPPKNGNGKPPPSNAYL 91
            ||||...:...|..:.||                 |:......|..:...|  |......:..|:
  Fly    26 RPPPTRASAGDGRYRGGNDGRYRGGGDGRYSGGNDGRYVHMDNKYKHDDRP--GGDYSGDAGRYV 88

  Fly    92 PPGNGNGGSSGGGGAGGGGGE-----------------------------------DIP------ 115
            ...|..||..||||.|||||.                                   ::|      
  Fly    89 GDKNRGGGGGGGGGGGGGGGSGAGGGGAAVVVPRTSARPQPRPTTAAPPAIADPTANLPKGRGTG 153

  Fly   116 -------IIKLESKVNTDGSYMYEYETGNGIKAEEMGYLKNAGVEGAEAQTAEGSFSYTSPEGQE 173
                   ||:.|..|..|| |.|.:||.|||..||.|.::....|  |...::|.:.||.|:|..
  Fly   154 EGGNGWAIIRQEDDVEVDG-YHYLWETENGILGEESGRIEKLTEE--EGLRSKGFYEYTGPDGIL 215

  Fly   174 ISLTYIADENGFQPQGDHLPTPPPIPIEIQEALDKLAA 211
            ..:.|:||:|||.|...||||.||.|..:::.|..|.|
  Fly   216 YRVDYVADDNGFVPSAAHLPTAPPPPPYVEKLLAFLEA 253

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AzNP_648031.1 Chitin_bind_4 129..185 CDD:278791 21/55 (38%)
Cpr49AbNP_610769.1 Chitin_bind_4 173..227 CDD:278791 21/55 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439120
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.