DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Az and Cpr47Ef

DIOPT Version :9

Sequence 1:NP_648031.1 Gene:Cpr65Az / 38712 FlyBaseID:FBgn0035686 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_610660.2 Gene:Cpr47Ef / 36194 FlyBaseID:FBgn0033603 Length:612 Species:Drosophila melanogaster


Alignment Length:242 Identity:88/242 - (36%)
Similarity:107/242 - (44%) Gaps:63/242 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    46 PPPAPANSYGPPKKGNGKPPPAPPKP-----------------SYGPPPKNGNGKPPPSNAYLPP 93
            ||||.|.|.|      |.|......|                 .||   ..|.|.|.......|.
  Fly    26 PPPASAASAG------GSPGAGLQGPGGGFGGGGGFGGGGAGGGYG---GGGGGGPAGGFGGGPG 81

  Fly    94 GNGNGGSSG----------------GGGAGGGG----------------GEDIPIIKLESKVNTD 126
            |.|.||..|                |||.||||                |..|||:...::.:.|
  Fly    82 GGGAGGFGGGNNGLGGFANGRPIAPGGGGGGGGAPAPRPSPSGGAPPTSGPPIPILSFVNENDGD 146

  Fly   127 GSYMYEYETGNGIKAEEMGYLKNAGVEGAEAQTAEGSFSYTSPEGQEISLTYIADENGFQPQGDH 191
            |:|.:.|||||||||:|.|.:||.|.|. |..:..||:|||:|||:.:.:.|.||||||.|.|:.
  Fly   147 GNYRFSYETGNGIKAQEEGTVKNKGSEN-EIPSVMGSYSYTNPEGELVEIMYTADENGFVPSGNA 210

  Fly   192 LPTPPPIPIEIQEALD----KLAAGGGCHGCDDNETGGNDDGGGGGY 234
            ||||||||..|.::|.    .:..|||..|....:..|...|||.||
  Fly   211 LPTPPPIPEAIAKSLAAQGISILPGGGYSGGPGGQGAGGGGGGGSGY 257

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AzNP_648031.1 Chitin_bind_4 129..185 CDD:278791 30/55 (55%)
Cpr47EfNP_610660.2 Chitin_bind_4 149..204 CDD:278791 30/55 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450045
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.