DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Az and Cpr47Ed

DIOPT Version :9

Sequence 1:NP_648031.1 Gene:Cpr65Az / 38712 FlyBaseID:FBgn0035686 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_610658.1 Gene:Cpr47Ed / 36192 FlyBaseID:FBgn0033601 Length:127 Species:Drosophila melanogaster


Alignment Length:91 Identity:27/91 - (29%)
Similarity:48/91 - (52%) Gaps:3/91 - (3%)


- Green bases have known domain annotations that are detailed below.


  Fly   114 IPIIKLESKVNTDGSYMYEYETGNGIKAEEMGYLKNAGVEGAEAQTAEGSFSYTSPEGQEISLTY 178
            :||:|..::..:.|||::.:|:.:|...||:|.:.:......:.....|.:.|.:..|||:.:.|
  Fly    28 VPILKSVTEQLSSGSYLFSFESADGTYREELGIVSSDSKTSDDDLEVSGIYRYINDWGQEVEVRY 92

  Fly   179 IADENGFQPQGDHL---PTPPPIPIE 201
            .||:|||.|...::   ....||.||
  Fly    93 TADKNGFLPHVRYISKGEAYKPIRIE 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AzNP_648031.1 Chitin_bind_4 129..185 CDD:278791 15/55 (27%)
Cpr47EdNP_610658.1 Chitin_bind_4 43..99 CDD:278791 15/55 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.