DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Az and Cpr47Ea

DIOPT Version :9

Sequence 1:NP_648031.1 Gene:Cpr65Az / 38712 FlyBaseID:FBgn0035686 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_610654.1 Gene:Cpr47Ea / 36188 FlyBaseID:FBgn0033597 Length:135 Species:Drosophila melanogaster


Alignment Length:108 Identity:52/108 - (48%)
Similarity:69/108 - (63%) Gaps:12/108 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly    91 LPPGNGNGGSSGGGGAGGGGGEDIPIIKLESKVNTDGSYMYEYETGNGIKAEEMGYLKNAGVEGA 155
            |||..||...:           :..|:|....:|.||||.|.|||.|||:|:|.|||||.|.: .
  Fly    29 LPPPRGNSFDA-----------NAVILKQNFDLNPDGSYQYNYETSNGIRADEAGYLKNPGSQ-I 81

  Fly   156 EAQTAEGSFSYTSPEGQEISLTYIADENGFQPQGDHLPTPPPI 198
            |||..:||:|||.|:|...::||||||||::.:|.|:|||||:
  Fly    82 EAQVMQGSYSYTGPDGVVYTITYIADENGYRAEGAHIPTPPPV 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AzNP_648031.1 Chitin_bind_4 129..185 CDD:278791 33/55 (60%)
Cpr47EaNP_610654.1 Chitin_bind_4 56..111 CDD:278791 33/55 (60%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439175
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.