DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Az and Lcp3

DIOPT Version :9

Sequence 1:NP_648031.1 Gene:Cpr65Az / 38712 FlyBaseID:FBgn0035686 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001260803.1 Gene:Lcp3 / 35819 FlyBaseID:FBgn0002534 Length:112 Species:Drosophila melanogaster


Alignment Length:86 Identity:32/86 - (37%)
Similarity:49/86 - (56%) Gaps:10/86 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   134 ETGNGIKAEEMGYLKNAGVEGAEAQTA--------EGSFSYTSPEGQEISLTYIADENGFQPQGD 190
            |..|.::.:  |::....::...|.:|        :|.|.:.||||..:.::|.|||||:|||.|
  Fly    24 ELVNDVQPD--GFVSKLVLDDGSASSATGDIHGNIDGVFEWISPEGVHVRVSYKADENGYQPQSD 86

  Fly   191 HLPTPPPIPIEIQEALDKLAA 211
            .||||||||..|.:|:..:.|
  Fly    87 LLPTPPPIPAAILKAIAYIEA 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AzNP_648031.1 Chitin_bind_4 129..185 CDD:278791 16/58 (28%)
Lcp3NP_001260803.1 Chitin_bind_4 40..81 CDD:278791 13/40 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439324
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.950

Return to query results.
Submit another query.