DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Az and Pcp

DIOPT Version :10

Sequence 1:NP_648031.1 Gene:Cpr65Az / 38712 FlyBaseID:FBgn0035686 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_476673.1 Gene:Pcp / 33985 FlyBaseID:FBgn0003046 Length:184 Species:Drosophila melanogaster


Alignment Length:62 Identity:20/62 - (32%)
Similarity:29/62 - (46%) Gaps:14/62 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 LGLQRETSS-MYKRTSSRDYSPMIDVEDSSGL-----LENDV---DNEM---ETTNPSWKCS 51
            |.|:|:.|| ::|..|.:..|.|  |.:|.||     :..|.   ||:.   ..|...|||:
  Fly   268 LDLKRQCSSAIFKCASDKTASDM--VRESGGLEPLVGIARDKTVRDNKQLLAAATGAIWKCA 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AzNP_648031.1 Chitin_bind_4 129..185 CDD:459790
PcpNP_476673.1 Chitin_bind_4 45..92 CDD:459790
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.