DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Az and Pcp

DIOPT Version :9

Sequence 1:NP_648031.1 Gene:Cpr65Az / 38712 FlyBaseID:FBgn0035686 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_476673.1 Gene:Pcp / 33985 FlyBaseID:FBgn0003046 Length:184 Species:Drosophila melanogaster


Alignment Length:109 Identity:37/109 - (33%)
Similarity:53/109 - (48%) Gaps:25/109 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    88 NAYLPPGNGNGGSSGGGGAGGGGGEDIPIIKLESKVNTDGSYMYEYETGNGIKAEEMGYLKNAGV 152
            ::|:|..:.|..:                ::.:.:|..||.|.|.|||.|||.|.:         
  Fly    20 SSYIPDSDRNTRT----------------LQNDLQVERDGKYRYAYETSNGISASQ--------- 59

  Fly   153 EGAEAQTAEGSFSYTSPEGQEISLTYIADENGFQPQGDHLPTPP 196
            ||......:|..|||||||:.||:.|:|||.|:.|.|.|:|..|
  Fly    60 EGLGGVAVQGGSSYTSPEGEVISVNYVADEFGYHPVGAHIPQVP 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AzNP_648031.1 Chitin_bind_4 129..185 CDD:278791 25/55 (45%)
PcpNP_476673.1 Chitin_bind_4 45..92 CDD:278791 25/55 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45439321
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.