DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Az and AgaP_AGAP012728

DIOPT Version :9

Sequence 1:NP_648031.1 Gene:Cpr65Az / 38712 FlyBaseID:FBgn0035686 Length:239 Species:Drosophila melanogaster
Sequence 2:XP_560629.5 Gene:AgaP_AGAP012728 / 3292280 VectorBaseID:AGAP012728 Length:207 Species:Anopheles gambiae


Alignment Length:144 Identity:64/144 - (44%)
Similarity:83/144 - (57%) Gaps:20/144 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 APPKPSYGPPPKNGNGKPPPSNAYLPPGNGNGGSSGGGGAGGGGGEDIPIIKLESKVNTDGSYMY 131
            ||..|.:.|...:...:.|..||..|                    .:||....:.|:.||||.|
Mosquito    48 APLLPPHNPTQFSQRLQQPFPNAIRP--------------------FVPITSYSNDVSYDGSYSY 92

  Fly   132 EYETGNGIKAEEMGYLKNAGVEGAEAQTAEGSFSYTSPEGQEISLTYIADENGFQPQGDHLPTPP 196
            .|.||:|.:.:..|||||||.:..|||..:||:||||||||.|::|||||||||:.:|.||||||
Mosquito    93 AYTTGDGQQQQAQGYLKNAGRKDLEAQAVQGSYSYTSPEGQLITVTYIADENGFRAEGAHLPTPP 157

  Fly   197 PIPIEIQEALDKLA 210
            |||..||::|..:|
Mosquito   158 PIPEAIQKSLALIA 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AzNP_648031.1 Chitin_bind_4 129..185 CDD:278791 34/55 (62%)
AgaP_AGAP012728XP_560629.5 Chitin_bind_4 90..146 CDD:278791 34/55 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 79 1.000 Domainoid score I15492
eggNOG 1 0.900 - - E1_2EQ63
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1459720at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.