powered by:
Protein Alignment Cpr65Az and CPR105
DIOPT Version :9
Sequence 1: | NP_648031.1 |
Gene: | Cpr65Az / 38712 |
FlyBaseID: | FBgn0035686 |
Length: | 239 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_556684.2 |
Gene: | CPR105 / 3290086 |
VectorBaseID: | AGAP006010 |
Length: | 105 |
Species: | Anopheles gambiae |
Alignment Length: | 65 |
Identity: | 26/65 - (40%) |
Similarity: | 34/65 - (52%) |
Gaps: | 3/65 - (4%) |
- Green bases have known domain annotations that are detailed below.
Fly 126 DGSYMYEYETGNGIKAEEMGYL---KNAGVEGAEAQTAEGSFSYTSPEGQEISLTYIADENGFQP 187
||||.:.|:..:..|.||...| ||...|...|.|..|.:.:|.|:|:...:.|.||||||.|
Mosquito 36 DGSYSFSYDQTDDHKREESAVLKTVKNFDNEDVPALTITGQYEFTDPDGKRYLVKYTADENGFNP 100
Fly 188 187
Mosquito 101 100
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_2EQ63 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
2 | 1.810 |
|
Return to query results.
Submit another query.