powered by:
Protein Alignment Cpr65Az and CPR103
DIOPT Version :9
Sequence 1: | NP_648031.1 |
Gene: | Cpr65Az / 38712 |
FlyBaseID: | FBgn0035686 |
Length: | 239 |
Species: | Drosophila melanogaster |
Sequence 2: | XP_556680.2 |
Gene: | CPR103 / 3290085 |
VectorBaseID: | AGAP006005 |
Length: | 134 |
Species: | Anopheles gambiae |
Alignment Length: | 72 |
Identity: | 22/72 - (30%) |
Similarity: | 36/72 - (50%) |
Gaps: | 6/72 - (8%) |
- Green bases have known domain annotations that are detailed below.
Fly 123 VNTDGSYMYEYET-GNGIKAEEMGYLKNAGVEGAEAQTAEGSFSYTSPEGQEISLTYIADENGFQ 186
::|:...::.|:| .|..:.|.:....|.| .....|.:.|..|:|....:.|:|||||::
Mosquito 37 ISTENGQLFSYKTKDNQWRDETVEIDPNTG-----KLVISGWYRYVGPDGVTYQVKYVADENGYR 96
Fly 187 PQGDHLP 193
|.|.|||
Mosquito 97 PLGMHLP 103
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
1 |
0.910 |
- |
- |
|
|
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.910 |
|
Return to query results.
Submit another query.