DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Az and Cpr11A

DIOPT Version :9

Sequence 1:NP_648031.1 Gene:Cpr65Az / 38712 FlyBaseID:FBgn0035686 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_572803.1 Gene:Cpr11A / 32198 FlyBaseID:FBgn0030394 Length:270 Species:Drosophila melanogaster


Alignment Length:186 Identity:46/186 - (24%)
Similarity:69/186 - (37%) Gaps:45/186 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    86 PSNAYLPPGNGNGGSSGGGGAGGGGGEDIPIIKLES--KVNTDGSYMYEYETGNGIKAEEMGYLK 148
            ||:.|..|.:.:........:|     |:...|.|:  ..|:...:..|.:|.|||:...:|.||
  Fly    33 PSDIYTLPEDIDDDKPAVHFSG-----DVMKAKTETLQNYNSGKKFKLELKTQNGIEVSSVGKLK 92

  Fly   149 NAGVEGAEAQTAEGSFSYTSPEGQEISLTYIADENGFQPQGD-HLPTPPPIPIE----------- 201
            :     .:.....||:|:|..:|:.....|.|||.|:.|..: .|..|.|.|:.           
  Fly    93 D-----DKTFVVSGSYSFTGADGKRYKTRYTADEFGYHPITELDLDIPEPQPLASAGQRQTVDPS 152

  Fly   202 -----------IQEALDK------LAAGGGCHGCDDNET----GGNDDGGGGGYVY 236
                       :|:.||.      ...|.|..|.|.:.|    .||..|.|.|..|
  Fly   153 SLLGNKNRFQFLQQTLDSDQGSQGPLRGSGQSGDDYSYTSPYGNGNAYGNGVGNGY 208

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AzNP_648031.1 Chitin_bind_4 129..185 CDD:278791 17/55 (31%)
Cpr11ANP_572803.1 Chitin_bind_4 73..124 CDD:278791 17/55 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.