powered by:
Protein Alignment Cpr65Az and Cpr65Av
DIOPT Version :9
Sequence 1: | NP_648031.1 |
Gene: | Cpr65Az / 38712 |
FlyBaseID: | FBgn0035686 |
Length: | 239 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_729146.1 |
Gene: | Cpr65Av / 318014 |
FlyBaseID: | FBgn0052405 |
Length: | 111 |
Species: | Drosophila melanogaster |
Alignment Length: | 71 |
Identity: | 38/71 - (53%) |
Similarity: | 50/71 - (70%) |
Gaps: | 2/71 - (2%) |
- Green bases have known domain annotations that are detailed below.
Fly 123 VNTDGSYMYEYETGNGIKAEEMGYLKNAGVEGAEAQTAEGSFSYTSPEGQEISLTYIADENGFQP 187
:.||| |.:.|||.:|:..:|...:||||.: .||.:..||.|:.:|:||..:|.||||||||||
Fly 41 IGTDG-YNFGYETSDGVTRQEQAEVKNAGTD-QEALSVRGSVSWVAPDGQTYTLHYIADENGFQP 103
Fly 188 QGDHLP 193
||||||
Fly 104 QGDHLP 109
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_2EQ63 |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
1 |
1.100 |
- |
- |
P |
PTHR10380 |
Phylome |
1 |
0.910 |
- |
- |
|
|
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.910 |
|
Return to query results.
Submit another query.