DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Az and Cpr49Aa

DIOPT Version :9

Sequence 1:NP_648031.1 Gene:Cpr65Az / 38712 FlyBaseID:FBgn0035686 Length:239 Species:Drosophila melanogaster
Sequence 2:NP_001097285.1 Gene:Cpr49Aa / 246413 FlyBaseID:FBgn0050045 Length:144 Species:Drosophila melanogaster


Alignment Length:104 Identity:73/104 - (70%)
Similarity:80/104 - (76%) Gaps:1/104 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly   107 GGGGGEDIPIIKLESKVNTDGSYMYEYETGNGIKAEEMGYLKNAGVEGAEAQTAEGSFSYTSPEG 171
            |...||.||||:.|.:||.||||.|.|||||||.|||.|||||.|.:.| .|.|:||||||||||
  Fly    24 GQAPGEPIPIIRQEQEVNFDGSYKYLYETGNGINAEEEGYLKNPGTDNA-GQVAQGSFSYTSPEG 87

  Fly   172 QEISLTYIADENGFQPQGDHLPTPPPIPIEIQEALDKLA 210
            ..|.:||:||||||||||||||||||||..||:||..||
  Fly    88 IPIRITYLADENGFQPQGDHLPTPPPIPPAIQKALAYLA 126

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65AzNP_648031.1 Chitin_bind_4 129..185 CDD:278791 38/55 (69%)
Cpr49AaNP_001097285.1 Chitin_bind_4 46..101 CDD:278791 38/55 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45450044
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D130767at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.850

Return to query results.
Submit another query.